Record in detail


General Info

  • lamp_id:L12A005777
  • Name:
  • FullName:
  • Source:
  • Mass:5536.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:12.34
  • Activity:AntiGram_p,AntiGram_n,Antiparasitic
  • Sequence
        LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07791|    From 23 To 68 E-value: 1e-21 Score: 93.2
        LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP
  • 2. L12A05777|    From 1 To 46 E-value: 8e-21 Score: 90.9
        LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP
  • 3. L12A07790|    From 27 To 56 E-value: 0.0000000005 Score: 54.7
        LFRGAKAIFRGARQGWRAHKVVSRYRNRDV
  • 4. L02A001377    From 5 To 34 E-value: 0.000000001 Score: 53.9
        LFRGAKAIFRGARQGWRAHKVVSRYRNRDV
  • 5. L01A001251    From 5 To 34 E-value: 0.00000001 Score: 50.1
        LFRGAKAIFRGARQGXRAHKVVSRYRNRDV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Bacillus subtilis CGMCC 1.108  MIC:  <3.1 μM  ( )  
  •   2  Target:  Bacillus subtilis CGMCC 1.108  MBC:  <3.1 μM  ( )  
  •   3  Target:  Corynebacterium glutamicum CGMCC 1.1886  MIC:  <1.6 μM  ( )  
  •   4  Target:  Corynebacterium glutamicum CGMCC 1.1886  MBC:  <3.1 μM  ( )  
  •   5  Target:  Micrococcus lysodeikticus CGMCC 1.0634  MIC:  <3.1 μM  ( )  
  •   6  Target:  Micrococcus lysodeikticus CGMCC 1.0634  MBC:  <3.1 μM  ( )  
  •   7  Target:  Micrococcus luteus CGMCC 1.634  MIC:  <1.6 μM  ( )  
  •   8  Target:  Micrococcus luteus CGMCC 1.634  MBC:  <1.6 μM  ( )  
  •   9  Target:  Staphylococcus epidermidis CGMCC 1.2429  MIC:  <12.5 μM  ( )  
  •   10  Target:  Staphylococcus epidermidis CGMCC 1.2429  MBC:  <12.5 μM  ( )  
  •   11  Target:  Aeromonas hydrophila CGMCC 1.1801  MIC:  <25 μM  ( )  
  •   12  Target:  Aeromonas hydrophila CGMCC 1.1801  MBC:  <25 μM  ( )  
  •   13  Target:  Escherichia coli ATCC 25922  MIC:  <12.5 μM  ( )  
  •   14  Target:  Escherichia coli ATCC 25922  MBC:  <25 μM  ( )  
  •   15  Target:  Pseudomonas aeruginosa CGMCC 1.0205  MIC:  >25 μM  ( )  
  •   16  Target:  Pseudomonas aeruginosa CGMCC 1.0205  MBC:  >25 μM  ( )  
  •   17  Target:  Pseudomonas fluorescens CGMCC 1.0032  MIC:  <1.6 μM  ( )  
  •   18  Target:  Pseudomonas fluorescens CGMCC 1.0032  MBC:  <6.2 μM  ( )  
  •   19  Target:  Pseudomonas stutzeri CGMCC 1.1803  MIC:  <3.1 μM  ( )  
  •   20  Target:  Pseudomonas stutzeri CGMCC 1.1803  MBC:  <12.5 μM  ( )  
  •   21  Target:  Shigella flexneri CGMCC 1.1868  MIC:  <1.6 μM  ( )  
  •   22  Target:  Shigella flexneri CGMCC 1.1868  MBC:  <25 μM  ( )  
  •   23  Target:  Vibrio alginolyticus CGMCC 1.1833  MIC:  <25 μM  ( )  
  •   24  Target:  Vibrio alginolyticus CGMCC 1.1833  MBC:  >25 μM  ( )  
  •   25  Target:  Vibrio fluvialis CGMCC 1.1609  MIC:  >25 μM  ( )  
  •   26  Target:  Vibrio fluvialis CGMCC 1.1609  MBC:  >25 μM  ( )  
  •   27  Target:  Vibrio harveyi CGMCC 1.1593  MIC:  <12.5 μM  ( )  
  •   28  Target:  Vibrio harveyi CGMCC 1.1593  MBC:  >12.5 μM  ( )  
  •   29  Target:  Vibrio parahaemolyticus CGMCC 1.1615  MIC:  >25 μM  ( )  
  •   30  Target:  Vibrio parahaemolyticus CGMCC 1.1615  MBC:  >25 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: