Record in detail


General Info

  • lamp_id:L12A006078
  • Name:
  • FullName:
  • Source:
  • Mass:6381.1 Da
  • Sequence Length:57 aa
  • Isoelectric Point:4.03
  • Activity:Antibacterial
  • Sequence
        LVLFLGLVSLSICEEEKRETEEEENDQEEDDKSEEKRFLSLLPSIVSGAVSLAKKLG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_06078

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06078|    From 1 To 57 E-value: 6e-26 Score: 107
        LVLFLGLVSLSICEEEKRETEEEENDQEEDDKSEEKRFLSLLPSIVSGAVSLAKKLG
  • 2. L12A06175|    From 10 To 66 E-value: 0.0000000000001 Score: 67
        FVLFLGLVSLSIRGEKKRETEEKEYDQGEDDKSEEKRFLSLIPHIVSGVASIAKHFG
  • 3. L12A06179|    From 10 To 66 E-value: 0.000000001 Score: 53.5
        LVLFLGLATLSICEEEKRETEEEEYNQEEDDKSEEKRFLSLIPHAINAVSTLVHHFG
  • 4. L12A06185|    From 18 To 66 E-value: 0.00000007 Score: 47.8
        SLSICEEEKRETEEEEHDQEEDDKSEEKRFLSLIPHIVSGVASIAKHLG
  • 5. L12A06187|    From 18 To 66 E-value: 0.00000009 Score: 47.4
        SLSICEEEKRETEEEEHDQEEDDKSEEKRFLSLIPHIVSGVASLAKHFG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Alcaligenes faecalis ATCC 8750  -:  NA -  ( )  
  •   2  Target:  Enterobacter aerogenes ATCC 13048  -:  NA -  ( )  
  •   3  Target:  Escherichia coli ATCC 11303  MIC:  12.5-25.0 μM  ( )  
  •   4  Target:  Micrococcus luteus ATCC 4698  -:  NA -  ( )  
  •   5  Target:  Staphylococcus epidermidis ATCC 14990  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: