Record in detail


General Info

  • lamp_id:L12A006191
  • Name:
  • FullName:
  • Source:
  • Mass:7874.9 Da
  • Sequence Length:70 aa
  • Isoelectric Point:5.74
  • Activity:Antimicrobial
  • Sequence
        MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKIAGHIAGSIGKKR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06191|    From 1 To 70 E-value: 7e-35 Score: 137
        MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKIAGHIAGSIGKKR
  • 2. L12A06194|    From 1 To 68 E-value: 4e-22 Score: 95.1
        MAFLKKSLFLVLFLGLVSLSICEKEKRQNGEDEDENEAANHEEGSEEKRGLFDIVKKVVGAI-GSLGKR
  • 3. L12A06177|    From 1 To 66 E-value: 3e-19 Score: 85.5
        MAFLKKSLFLVLFLGFVSVSICEEEKRQEDEDEHVEEGENQEEGSEEKRGLLSVLGSVAKHVLPHV
  • 4. L12A06176|    From 1 To 62 E-value: 0.000000000000001 Score: 73.6
        MAFLKKSLFLGLFLGFVSVSICEEEKRQEDEDEHDEEGENQEEGSEEKRGLLSVLGSVAKHV
  • 5. L12A06193|    From 1 To 68 E-value: 0.00000000000003 Score: 68.9
        MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAL-GSLGKR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Enterococcus faecalis  MIC:  4 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus  MIC:  4 μg/ml  ( )  
  •   3  Target:  Staphylococcus epidermidis  MIC:  4 μg/ml  ( )  
  •   4  Target:  Streptococcus mitis  MIC:  1 μg/ml  ( )  
  •   5  Target:  Streptococcus pneumoniae  MIC:  0.5 μg/ml  ( )  
  •   6  Target:  Streptococcus pyogenes  MIC:  0.5 μg/ml  ( )  
  •   7  Target:  Corynebacterium jeikeium  MIC:  4 μg/ml  ( )  
  •   8  Target:  Acinetobacter calcoaceticus  MIC:  4 μg/ml  ( )  
  •   9  Target:  Enterobacter cloacae  MIC:  256 μg/ml  ( )  
  •   10  Target:  Escherichia coli  MIC:  64 μg/ml  ( )  
  •   11  Target:  Klebsiella pneumoniae  MIC:  64 μg/ml  ( )  
  •   12  Target:  Pseudomonas aeruginosa  MIC:  256 μg/ml  ( )  
  •   13  Target:  Stenotrophomonas maltophilia  MIC:  32 μg/ml  ( )  
  •   14  Target:  Serratia marcescens  MIC:  256 μg/ml  ( )  
  •   15  Target:  Candida albicans  MIC:  32 μg/ml  ( )  
  •   16  Target:  Cryptococcus neoformans  MIC:  1 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: