Record in detail


General Info

  • lamp_id:L12A006234
  • Name:
  • FullName:
  • Source:
  • Mass:8868.5 Da
  • Sequence Length:79 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        MAGVNSLRSALYLIILILFVQLTNFQESRVMAVELSRVFLPLSGVPCGESCVWMYCISAAMGCSCRNKVCYRNEIIQEK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06234|    From 1 To 79 E-value: 6.00036e-42 Score: 160
        MAGVNSLRSALYLIILILFVQLTNFQESRVMAVELSRVFLPLSGVPCGESCVWMYCISAAMGCSCRNKVCYRNEIIQEK
  • 2. L12A06233|    From 1 To 79 E-value: 5.99994e-41 Score: 157
        MAGVNSLRSALYLIILILFVQLTNFQESRVMAVELSRVFLPLSGIPCGESCVWMYCITATMGCSCRNKVCYKNEIIQEK
  • 3. L12A09593|    From 1 To 79 E-value: 2e-30 Score: 122
        MVRVNSLRSALYLIVLILFVQLTCFSDARVMDVDLSRAFLPLTGIGCGESCVWIPCVSAAIGCSCSNKICYRNGIIPEK
  • 4. L01A000224    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        GIPCGESCVWIPCISAALGCSCKNKVCYRN
  • 5. L06AT00168    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        GIPCGESCVWIPCISAAIGCSCKNKVCYRN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli DH5alpha  MIC:  4 μM  ( )  
  •   2  Target:  Bacillus subtilis DSM 357  MIC:  3 μM  ( )  
  •   3  Target:  Escherichia coli LWF+  MIC:  18 μM  ( )  
  •   4  Target:  Bacillus subtilis L170  MIC:  50 μM  ( )  
  •   5  Target:  Escherichia coli DH5alpha  MIC:  3.1 μM  ( )  
  •   6  Target:  Bacillus subtilis DSM 347  MIC:  3.1 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: