Record in detail


General Info

  • lamp_id:L12A006236
  • Name:
  • FullName:
  • Source:
  • Mass:10082.9 Da
  • Sequence Length:93 aa
  • Isoelectric Point:7.01
  • Activity:Antimicrobial
  • Sequence
        MAHFIKYLIMFLVIAACVGVLEVESAEADLTALGIRKMLDPPTEVGISFAAEIQFKKELLGRLKGIQCGESCVWIPCISSAWGCSCKNKICSS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06236|    From 1 To 93 E-value: 0 Score: 188
        MAHFIKYLIMFLVIAACVGVLEVESAEADLTALGIRKMLDPPTEVGISFAAEIQFKKELLGRLKGIQCGESCVWIPCISSAWGCSCKNKICSS
  • 2. L12A06262|    From 1 To 71 E-value: 0.000000000003 Score: 62
        MAKFANYLTLFLLVASLVMMEVHSSSSTEVPDQGRRLLMNPDS--------------------NGIPCGESCVFIPCISALLGCSCSNKVC
  • 3. L12A06261|    From 1 To 73 E-value: 0.000000000006 Score: 61.2
        MAKFANYLMLFLLVASLV-MLEAQSSDTLKVPDLGKRLLMNHDSN-----------------RV-GIPCGESCVYIPCISAVLGCSCQNKVC
  • 4. L11A004697    From 1 To 28 E-value: 0.00000000002 Score: 59.7
        IQCGESCVWIPCISSAWGCSCKNKICSS
  • 5. L12A06260|    From 1 To 74 E-value: 0.0000000003 Score: 55.5
        MAKFANYLMLFLLVASLV-MLEAQSSDTIKVPDLGKRLLMNRDP----------------------NGIPCAESCVWIPCTITALMGCSCKNNVCYN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli DH5alpha  MIC:  11 μM  ( )  
  •   2  Target:  Bacillus subtilis DSM 357  MIC:  3 μM  ( )  
  •   3  Target:  Escherichia coli LWF+  MIC:  19 μM  ( )  
  •   4  Target:  Bacillus subtilis L170  MIC:  50 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: