Record in detail


General Info

  • lamp_id:L12A006690
  • Name:
  • FullName:
  • Source:
  • Mass:5632.3 Da
  • Sequence Length:52 aa
  • Isoelectric Point:6.36
  • Activity:Antibacterial
  • Sequence
        MEAVKEKNDLFNLDVKVNAKESNDSGAEPRIASKFICTPGCAKTGSFNSYCC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_06690

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06690|    From 1 To 52 E-value: 5e-26 Score: 108
        MEAVKEKNDLFNLDVKVNAKESNDSGAEPRIASKFICTPGCAKTGSFNSYCC
  • 2. L12A06691|    From 1 To 52 E-value: 8e-25 Score: 103
        MEAVKEKNELFDLDVKVNAKESNDSGAEPRIASKFLCTPGCAKTGSFNSYCC
  • 3. L12A06749|    From 4 To 47 E-value: 0.00000000008 Score: 57.4
        VLDLDVQVKANNNSNDSAGDERITSHSLCTPGCAKTGSFNSFCC
  • 4. L12A06750|    From 4 To 47 E-value: 0.000000002 Score: 53.1
        VLDLDVQVKGNNNTNDSAADERITSHFLCSFGCGKTGSFNSFCC
  • 5. L12A07550|    From 2 To 46 E-value: 0.00000001 Score: 50.4
        INEKN-LFDLDVQVTTASGD---VDPQITSISACTPGCGNTGSFNSFCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Salmonella typhimurium ATCC 13311  MIC:  20 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 33592  MIC:  20 μg/ml  ( )  
  •   3  Target:  Mycobacterium ranae ATCC 110  MIC:  6.0 μg/ml  ( )  
  •   4  Target:  Bacillus subtilis ATCC 43223  MIC:  2.0 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: