Record in detail


General Info

  • lamp_id:L12A006816
  • Name:
  • FullName:
  • Source:
  • Mass:4185.8 Da
  • Sequence Length:40 aa
  • Isoelectric Point:3.93
  • Activity:Antibacterial
  • Sequence
        METPVVQPRDWTCWSCLVCAACSVELLNLVTAATGASTAS
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_06816

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06816|    From 1 To 40 E-value: 1e-17 Score: 80.5
        METPVVQPRDWTCWSCLVCAACSVELLNLVTAATGASTAS
  • 2. L04ABAC177    From 1 To 31 E-value: 0.000000000008 Score: 60.8
        DWTCWSCLVCAACSVELLNLVTAATGASTAS
  • 3. L01A003110    From 1 To 18 E-value: 0.003 Score: 32.3
        DWTAWSALVAAACSVELL
  • 4. L13A028071    From 1 To 14 E-value: 0.004 Score: 32
        DWTCWSCLVCAACS
  • 5. L04ABAC009    From 1 To 18 E-value: 0.007 Score: 31.2
        DWTXWSXLVXAACSVELL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 11219  MIC:  10 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 13388  MIC:  20 μM  ( )  
  •   3  Target:  Salmonella enterica serovar Typhimurium ATCC 14028  MIC:  20 μM  ( )  
  •   4  Target:  Klebsiella pneumoniae ATCC 10031  MIC:  10 μM  ( )  
  •   5  Target:  Staphylococcus aureus ATCC 6538  MIC:  10 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: