Record in detail


General Info

  • lamp_id:L12A006899
  • Name:
  • FullName:
  • Source:
  • Mass:4992.7 Da
  • Sequence Length:49 aa
  • Isoelectric Point:3.71
  • Activity:Antibacterial
  • Sequence
        MEVLNKQNVNIIPESEEVGGWVACVGACGTVCLASGGVGTEFAAASYFL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_06899

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06899|    From 1 To 49 E-value: 3e-23 Score: 98.6
        MEVLNKQNVNIIPESEEVGGWVACVGACGTVCLASGGVGTEFAAASYFL
  • 2. L13A027287    From 1 To 30 E-value: 0.00000000001 Score: 60.5
        GWVACVGACGTVCLASGGVGTEFAAASYFL
  • 3. L12A06900|    From 1 To 43 E-value: 0.051 Score: 28.1
        MEVMN--NALITKVDEEIGGNAACVIGCIGSCVISEGIGSLVGTA
  • 4. L12A07966|    From 12 To 34 E-value: 9.7 Score: 20.8
        LGILGT-CLAGIGTGIKVDAATYY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Botrytis cinerea  MIC:  >100 μg/ml  ( )  
  •   2  Target:  Alternaria alternata  MIC:  >100 μg/ml  ( )  
  •   3  Target:  Cladosporium herbarum  MIC:  20 μg/ml  ( )  
  •   4  Target:  Clavibacter michiganensis ssp. michiganensis DSM 4  MIC:  >40 μg/ml  ( )  
  •   5  Target:  Pectobacterium carotovorum ssp. carotovorum DSM 30  MIC:  >40 μg/ml  ( )  
  •   6  Target:  Xanthomonas vesicatoria DSM 50861  MIC:  >40 μg/ml  ( )  
  •   7  Target:  Pseudomonas syringae pv. tomato DC3000  MIC:  5 μg/ml  ( )  
  •   8  Target:  Pseudomonas syringae pv. syringae DSM 10604  MIC:  >40 μg/ml  ( )  
  •   9  Target:  Pseudomonas corrugata DSM 7228  MIC:  10 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: