Record in detail


General Info

  • lamp_id:L12A006910
  • Name:
  • FullName:
  • Source:
  • Mass:6418.6 Da
  • Sequence Length:63 aa
  • Isoelectric Point:10.58
  • Activity:Antibacterial
  • Sequence
        MFDLVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_06910

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06910|    From 1 To 63 E-value: 2e-29 Score: 119
        MFDLVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
  • 2. L02A001651    From 1 To 60 E-value: 2e-27 Score: 112
        LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
  • 3. L13A010490    From 1 To 50 E-value: 1e-21 Score: 93.6
        LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQ
  • 4. L12A08466|    From 2 To 50 E-value: 0.001 Score: 33.5
        LYELVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVK
  • 5. L01A002781    From 1 To 58 E-value: 0.027 Score: 29.3
        LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Aspergillus flavus ATCC 9643  MIC:  50 μM  ( )  
  •   2  Target:  Aspergillus flavus ATCC 9643  MIC:  9.4 μM  ( )  
  •   3  Target:  Aspergillus fumigatus ATCC 26430  MIC:  6.2 μM  ( )  
  •   4  Target:  Aspergillus fumigatus ATCC 26430  MIC:  25 μM  ( )  
  •   5  Target:  Candida albicans ATCC 10231  MIC:  25 μM  ( )  
  •   6  Target:  Candida albicans ATCC 10231  MIC:  12.5 μM  ( )  
  •   7  Target:  Escherichia coli ATCC 25922  MIC:  100 μM  ( )  
  •   8  Target:  Escherichia coli ATCC 25922  MIC:  100 μM  ( )  
  •   9  Target:  Escherichia coli D21  MIC:  100 μM  ( )  
  •   10  Target:  Escherichia coli D21  MIC:  100 μM  ( )  
  •   11  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  100 μM  ( )  
  •   12  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  100 μM  ( )  
  •   13  Target:  Acinetobacter baumannii ATCC 19606  MIC:  >100 μM  ( )  
  •   14  Target:  Acinetobacter baumannii ATCC 19606  MIC:  100 μM  ( )  
  •   15  Target:  Staphylococcus aureus II ATCC 6538P  MIC:  100 μM  ( )  
  •   16  Target:  Staphylococcus aureus II ATCC 6538P  MIC:  100 μM  ( )  
  •   17  Target:  Enterococcus faecalis ATCC 19433  MIC:  100 μM  ( )  
  •   18  Target:  Enterococcus faecalis ATCC 19433  MIC:  25 μM  ( )  
  •   19  Target:  Enterobacter cloacae ATCC 49141  MIC:  100 μM  ( )  
  •   20  Target:  Enterobacter cloacae ATCC 49141  MIC:  62 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: