Record in detail


General Info

  • lamp_id:L12A007008
  • Name:
  • FullName:
  • Source:
  • Mass:7381.5 Da
  • Sequence Length:64 aa
  • Isoelectric Point:4.63
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSLFLIFFLGTINLSLCEEERDADEEERRDDPEERAVEVEKRSLILKGLAGLVQKILGK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07008|    From 1 To 64 E-value: 4e-31 Score: 125
        MFTLKKSLFLIFFLGTINLSLCEEERDADEEERRDDPEERAVEVEKRSLILKGLAGLVQKILGK
  • 2. L01A003834    From 1 To 62 E-value: 1e-19 Score: 86.7
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPL--LAGVVANFLPQ
  • 3. L12A07168|    From 1 To 62 E-value: 2e-18 Score: 82.8
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPL--LAGLAANFLPQ
  • 4. L12A07293|    From 1 To 66 E-value: 2e-16 Score: 76.3
        MFTMKKSLLLLFFLGTINLSLCEQERNADEEERRDDPDERDVEVEKRFLPLIASLAANFVPKIFCK
  • 5. L12A07345|    From 1 To 46 E-value: 0.000000000000001 Score: 73.6
        MFTMKKSMLLLFFLGTINLSLCEQERDA-EEERRDDEDKRDVEVEKR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  12.5 μM  ( )  
  •   2  Target:  Staphylococcus aureus NCTC 8325  MIC:  50 μM  ( )  
  •   3  Target:  Candida albicans ATCC 90028  MIC:  100 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: