Record in detail


General Info

  • lamp_id:L12A007035
  • Name:
  • FullName:
  • Source:
  • Mass:7812 Da
  • Sequence Length:66 aa
  • Isoelectric Point:5.16
  • Activity:Antibacterial
  • Sequence
        MFTLKKSLLLLFFIGVIKLSLCEEERNADEEERRDDPDEMDVEMEKRLALKSGGWLRLFGLKDKKH
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07035|    From 1 To 66 E-value: 9e-33 Score: 130
        MFTLKKSLLLLFFIGVIKLSLCEEERNADEEERRDDPDEMDVEMEKRLALKSGGWLRLFGLKDKKH
  • 2. L12A07034|    From 1 To 66 E-value: 3e-32 Score: 129
        MFTLKKSLLLLFFIGVIKLSLCEEERNADEEERRDDPDEMDVEMEKRLALESGGWLRLFGLKDKKH
  • 3. L12A07036|    From 1 To 66 E-value: 1e-19 Score: 87
        MFTLKKSLLLLFFIGVIKLSLCEEERSADEEKRRDDPDEMDVEVEKRLALERRDGWLRLFGLKTRR
  • 4. L12A07037|    From 1 To 66 E-value: 4e-19 Score: 85.1
        MFTLKKSLLLLFFIGVIKLSLCEEERSADEEKRRDDPDEMDVEVEKRLALERRDGWLRLFGPKTRR
  • 5. L12A07168|    From 1 To 54 E-value: 1e-18 Score: 83.2
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Micrococcus luteus  MIC:  0.4-0.8 μM  ( )  
  •   2  Target:  Bacillus cereus  MIC:  >50 μM  ( )  
  •   3  Target:  Bacillus subtilis  MIC:  1.6-3.12 μM  ( )  
  •   4  Target:  Bacillus megaterium  MIC:  12.5-25 μM  ( )  
  •   5  Target:  Bacillus epiphytus  MIC:  0.2-0.4 μM  ( )  
  •   6  Target:  Staphylococcus haemolyticus  -:  NA -  ( )  
  •   7  Target:  Escherichia coli  MIC:  25-50 μM  ( )  
  •   8  Target:  Cryptococcus neoformans Steroform A  MIC:  3.12-6.25 μM  ( )  
  •   9  Target:  Cryptococcus neoformans Steroform B  MIC:  1.6-3.12 μM  ( )  
  •   10  Target:  Cryptococcus neoformans Steroform C  MIC:  1.6-3.12 μM  ( )  
  •   11  Target:  Cryptococcus neoformans Steroform D  MIC:  0.8-1.6 μM  ( )  
  •   12  Target:  Candida albicans A39  MIC:  6.25-12.5 μM  ( )  
  •   13  Target:  Candida lipolytica  MIC:  6.25-12.5 μM  ( )  
  •   14  Target:  Candida inconspicua  MIC:  3.12-6.25 μM  ( )  
  •   15  Target:  Candida krusei  MIC:  6.25-12.5 μM  ( )  
  •   16  Target:  Candida lusitaniae  MIC:  6.25-12.5 μM  ( )  
  •   17  Target:  Candida glabrata  MIC:  6.25-12.5 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: