Record in detail


General Info

  • lamp_id:L12A007168
  • Name:
  • FullName:
  • Source:
  • Mass:8200.6 Da
  • Sequence Length:71 aa
  • Isoelectric Point:5.05
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGLAANFLPQIICKIARKC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07168|    From 1 To 71 E-value: 9e-37 Score: 143
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGLAANFLPQIICKIARKC
  • 2. L01A003834    From 1 To 71 E-value: 4e-33 Score: 131
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPLLAGVVANFLPQIICKIARKC
  • 3. L12A07293|    From 1 To 71 E-value: 5e-27 Score: 111
        MFTMKKSLLLLFFLGTINLSLCEQERNADEEERRDDPDERDVEVEKRFLPLIASLAANFVPKIFCKITKKC
  • 4. L12A07078|    From 1 To 71 E-value: 9e-25 Score: 103
        MFTLKKSLLLLFFLGTINLSLCEQERNADEEERRDDPDERDVEVEKRFLPLIASLAANFVPKIFCKITKKC
  • 5. L12A07071|    From 1 To 70 E-value: 1e-24 Score: 103
        MFTLKKSLLLLFFLGTINLSLCEQERDADEEERRDDPDERDVEVEKRFLPLLAGLAANFLPKLFCKITRK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli KCTC 1682  MIC:  2.0 μM  ( )  
  •   2  Target:  Escherichia coli KCTC 2593  MIC:  2.0 μM  ( )  
  •   3  Target:  Escherichia coli KCTC 2571  MIC:  2.0 μM  ( )  
  •   4  Target:  Pseudomonas aeruginosa KCTC 1637  MIC:  4.0 μM  ( )  
  •   5  Target:  Pseudomonas aeruginosa KCTC 2004  MIC:  8.0 μM  ( )  
  •   6  Target:  Pseudomonas aeruginosa KCTC 2513  MIC:  8.0 μM  ( )  
  •   7  Target:  Salmonella typhimurium KCTC 1926  MIC:  16 μM  ( )  
  •   8  Target:  Bacillus subtilis KCTC 3068  MIC:  4.0 μM  ( )  
  •   9  Target:  Bacillus subtilis KCTC 1021  MIC:  8.0 μM  ( )  
  •   10  Target:  Bacillus subtilis KCTC 1022  MIC:  1.0 μM  ( )  
  •   11  Target:  Staphylococcus epidermidis KCTC 1917  MIC:  2.0 μM  ( )  
  •   12  Target:  Staphylococcus aureus KCTC 1621  MIC:  4.0 μM  ( )  
  •   13  Target:  Staphylococcus aureus KCTC 1916  MIC:  1.0 μM  ( )  
  •   14  Target:  Staphylococcus aureus KCTC 3881  MIC:  2.0 μM  ( )  
  •   15  Target:  Staphylococcus aureus CCARM 3089  MIC:  16 μM  ( )  
  •   16  Target:  Staphylococcus aureus CCARM 3090  MIC:  16 μM  ( )  
  •   17  Target:  Staphylococcus aureus CCARM 3108  MIC:  16 μM  ( )  
  •   18  Target:  Staphylococcus aureus CCARM 3114  MIC:  16 μM  ( )  
  •   19  Target:  Staphylococcus aureus CCARM 3126  MIC:  16 μM  ( )  
  •   20  Target:  Salmonella typhimurium CCARM 8003  MIC:  32 μM  ( )  
  •   21  Target:  Salmonella typhimurium CCARM 8007  MIC:  16 μM  ( )  
  •   22  Target:  Salmonella typhimurium CCARM 8009  MIC:  16 μM  ( )  
  •   23  Target:  Escherichia coli CCARM 1229  MIC:  16 μM  ( )  
  •   24  Target:  Escherichia coli CCARM 1238  MIC:  16 μM  ( )  
  •   25  Target:  Acinetobacter baumannii CCARM 12005  MIC:  4.0 μM  ( )  
  •   26  Target:  Acinetobacter baumannii CCARM 12035  MIC:  4.0 μM  ( )  
  •   27  Target:  Acinetobacter baumannii CCARM 12036  MIC:  4.0 μM  ( )  
  •   28  Target:  Acinetobacter baumannii CCARM 12037  MIC:  4.0 μM  ( )  
  •   29  Target:  Pseudomonas aeruginosa CCARM 2002  MIC:  4.0 μM  ( )  
  •   30  Target:  Pseudomonas aeruginosa CCARM 2003  MIC:  4.0 μM  ( )  
  •   31  Target:  Pseudomonas aeruginosa CCARM 2095  MIC:  4.0 μM  ( )  
  •   32  Target:  Pseudomonas aeruginosa CCARM 2163  MIC:  4.0 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: