Record in detail


General Info

  • lamp_id:L12A007207
  • Name:
  • FullName:
  • Source:
  • Mass:8025.3 Da
  • Sequence Length:70 aa
  • Isoelectric Point:5.13
  • Activity:Antimicrobial
  • Sequence
        MFTMKKPLLLLFFLGTINLSLCEEERNAEEERRDDDDKMDAEVEKRFLPGLIKAAVGIGSTIFCKISRKC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07207|    From 1 To 70 E-value: 5e-36 Score: 141
        MFTMKKPLLLLFFLGTINLSLCEEERNAEEERRDDDDKMDAEVEKRFLPGLIKAAVGIGSTIFCKISRKC
  • 2. L12A07365|    From 1 To 70 E-value: 1e-22 Score: 97.1
        MFTTKKPMLLLFFLGTINFSLCEQERDAEEERRDDQDKRDVEVEKRFFLPLLGAAAQVLPSLICKIFKKC
  • 3. L12A07221|    From 1 To 67 E-value: 5e-22 Score: 94.7
        MFTMKKPMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFALGAVTKRL---PSLFCLITRRC
  • 4. L12A07168|    From 1 To 71 E-value: 8e-22 Score: 94.4
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGLAANFLPQIICKIARKC
  • 5. L12A07345|    From 1 To 67 E-value: 1e-21 Score: 93.6
        MFTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFALG---AVTKLLPSLLCMISRKC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli BL21AI  MIC:  1 μg/ml  ( )  
  •   2  Target:  Klebsiella pneumoniae DSM 681  MIC:  2 μg/ml  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  0.3±0.1 μM  ( )  
  •   4  Target:  Escherichia coli ATCC 11775  MIC:  0.5±0.1 μM  ( )  
  •   5  Target:  Escherichia coli ATCC 35218  MIC:  0.2±0.1 μM  ( )  
  •   6  Target:  Salmonella typhimurium ATCC 14028  MIC:  1.8±0.2 μM  ( )  
  •   7  Target:  Salmonella typhi Vi+  MIC:  1.3±0.3 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: