Record in detail


General Info

  • lamp_id:L12A007246
  • Name:
  • FullName:
  • Source:
  • Mass:8440.6 Da
  • Sequence Length:75 aa
  • Isoelectric Point:4.64
  • Activity:Antimicrobial
  • Sequence
        MFTMKKSLLFPFFLGTISLSFCEEERSADEDDEGEMTEEEKRSIRDKIKTIAIDLAKSAGTGVLKTLICKLDKSC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07246|    From 1 To 75 E-value: 5e-38 Score: 147
        MFTMKKSLLFPFFLGTISLSFCEEERSADEDDEGEMTEEEKRSIRDKIKTIAIDLAKSAGTGVLKTLICKLDKSC
  • 2. L12A07233|    From 1 To 75 E-value: 8e-37 Score: 143
        MFTMKKSLLFLFFLGTISLSFCEEERSADEDDEGEMTEEEKRSIRDKIKTIAIDLAKSAGTGVLKTLICKLDKSC
  • 3. L12A07236|    From 1 To 75 E-value: 2e-36 Score: 142
        MFTMKKSLLFLFFLGTISLSFCEEERSADEDDEGEMTEEEKRSIRDKIKTMAIDLAKSAGTGVLKTLICKLDKSC
  • 4. L12A07244|    From 1 To 75 E-value: 3e-36 Score: 141
        MFTMKKSLLFLFFLGTTSLSFCEEERSADEDDEGEMTEEEKRSIRDKIKTIAIDLAKSAGTGVLKTLICKLDKSC
  • 5. L12A07237|    From 1 To 75 E-value: 3e-36 Score: 141
        MFTMKKSLLFLFFLGTISLSFCEEERSADEDDEGEMTEEEKRSIRDKIKTTAIDLAKSAGTGVLKTLICKLDKSC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Candida albicans CMCC 98001  MIC:  6.25 μM  ( )  
  •   2  Target:  Candida albicans CMCC 98001  MBC:  25 μM  ( )  
  •   3  Target:  Streptococcus mutans CGMCC 1.2500  MIC:  6.25 μM  ( )  
  •   4  Target:  Streptococcus mutans CGMCC 1.2500  MBC:  25 μM  ( )  
  •   5  Target:  Streptococcus salivarius CGMCC 1.2498  MIC:  6.25 μM  ( )  
  •   6  Target:  Streptococcus salivarius CGMCC 1.2498  MBC:  25 μM  ( )  
  •   7  Target:  Streptococcus sanguinis CGMCC 1.2497  MIC:  6.25 μM  ( )  
  •   8  Target:  Streptococcus sanguinis CGMCC 1.2497  MBC:  25 μM  ( )  
  •   9  Target:  Lactobacillus acidophilus CGMCC 1.1854  MIC:  6.25 μM  ( )  
  •   10  Target:  Lactobacillus acidophilus CGMCC 1.1854  MBC:  25 μM  ( )  
  •   11  Target:  Fusobacterium nucleatum CGMCC 1.2526  MIC:  6.25 μM  ( )  
  •   12  Target:  Fusobacterium nucleatum CGMCC 1.2526  MBC:  25 μM  ( )  
  •   13  Target:  Escherichia coli AS1.349  MIC:  6.25 μM  ( )  
  •   14  Target:  Pseudomonas aeruginosa CGMCC 1.860  MIC:  6.25 μM  ( )  
  •   15  Target:  Enterobacter aerogenes CGMCC 1.876  MIC:  7.81 μM  ( )  
  •   16  Target:  Enterobacter cloacae CGMCC 1.58  MIC:  7.81 μM  ( )  
  •   17  Target:  Klebsiella pneumoniae subsp. pneumoniae CGMCC 1.17  MIC:  6.25 μM  ( )  
  •   18  Target:  Staphylococcus aureus AS1.72  MIC:  6.25 μM  ( )  
  •   19  Target:  Bacillus cereus AS1.126  MIC:  3.12 μM  ( )  
  •   20  Target:  Streptococcus lactis AS1.1690  MIC:  3.12 μM  ( )  
  •   21  Target:  Enterococcus faecalis CGMCC 1.595  MIC:  7.81 μM  ( )  
  •   22  Target:  Enterococcus faecium CGMCC 1.2334  MIC:  7.81 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: