Record in detail


General Info

  • lamp_id:L12A007279
  • Name:
  • FullName:
  • Source:
  • Mass:7822.1 Da
  • Sequence Length:72 aa
  • Isoelectric Point:6.51
  • Activity:Antimicrobial
  • Sequence
        MFTMKKSLLLLFFLGMISLSLCQDERGADEDDGGEMTEEEKRGAFGNFLKGVAKKAGLKILSIAQCKLSGTC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07279|    From 1 To 72 E-value: 3e-36 Score: 141
        MFTMKKSLLLLFFLGMISLSLCQDERGADEDDGGEMTEEEKRGAFGNFLKGVAKKAGLKILSIAQCKLSGTC
  • 2. L12A07280|    From 1 To 72 E-value: 2e-35 Score: 139
        MFTMKKSLLLLFFLGMISLSLCQDERGADVDDGGEMTEEEKRGAFGNFLKGVAKKAGLKILSIAQCKLSGTC
  • 3. L12A07344|    From 1 To 72 E-value: 8e-35 Score: 137
        MFTMKKSMLLLFFLGMISLSLCQDERGADEDDGGEMTEEEKRGAFGDFLKGAAKKAGLKILSIAQCKLSGTC
  • 4. L12A07001|    From 1 To 72 E-value: 4e-34 Score: 134
        MFTLKKPLLLLVFLGMISLSLCQDERGADEDDGGEMTEEEKRGAFGNLLKGVAKKAGLKILSIAQCKLSGTC
  • 5. L12A07165|    From 1 To 72 E-value: 3e-33 Score: 132
        MFTLKKSMLLLFFLGMISMSLCQDERGADEDDGGEMTEEEKRGAFGDFLKGAAKKAGLKILSIAQCKLFGTC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Klebsiella pneumoniae ATCC 700603  MIC:  50 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 25922  MIC:  50 μM  ( )  
  •   3  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  >100 μM  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 33591  MIC:  >100 μM  ( )  
  •   5  Target:  Staphylococcus aureus ATCC 700699 MU50  MIC:  100 μM  ( )  
  •   6  Target:  Staphylococcus aureus ATCC 29213  MIC:  >100 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: