Record in detail


General Info

  • lamp_id:L12A007289
  • Name:
  • FullName:
  • Source:
  • Mass:7923.3 Da
  • Sequence Length:70 aa
  • Isoelectric Point:5.1
  • Activity:Antimicrobial
  • Sequence
        MFTMKKSLLLLFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKIAAGILPTAICKGFKKC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07289|    From 1 To 70 E-value: 4e-36 Score: 141
        MFTMKKSLLLLFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKIAAGILPTAICKGFKKC
  • 2. L12A07290|    From 1 To 70 E-value: 4e-35 Score: 138
        MFTMKKSLLLLFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKIAAGILPTAICKIFKKC
  • 3. L12A07253|    From 1 To 70 E-value: 8e-29 Score: 117
        MFTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKIAAGILPTAICKIFKKC
  • 4. L12A07229|    From 1 To 70 E-value: 3e-28 Score: 115
        MFTMKKSLLFLFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKMATSILPTAICKGFKKC
  • 5. L12A07254|    From 1 To 70 E-value: 8e-28 Score: 114
        MFTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKIATSILPTAICKIFKKC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Vibrio alginolyticus  -:  NA -  ( )  
  •   2  Target:  Vibrio harveyi BCRC 13812  -:  NA -  ( )  
  •   3  Target:  Vibrio vulnificus 204  -:  NA -  ( )  
  •   4  Target:  Micrococcus luteus BCRC 11034  -:  NA -  ( )  
  •   5  Target:  Staphylococcus aureus BCRC 10780  -:  NA -  ( )  
  •   6  Target:  Streptococcus pneumoniae BCRC 10794  -:  NA -  ( )  
  •   7  Target:  Streptococcus agalactiae  -:  NA -  ( )  
  •   8  Target:  Staphylococcus sp. BCRC 10451  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: