Record in detail


General Info

  • lamp_id:L12A007361
  • Name:
  • FullName:
  • Source:
  • Mass:8472.8 Da
  • Sequence Length:78 aa
  • Isoelectric Point:6.54
  • Activity:Antimicrobial
  • Sequence
        MFTSKKSMLLFFFLGTISLSLCQEEERGADEDEVVEEEVKRGLLSVFKGVLKTAGKNVAKNVAGSLLDQLKCKISGGC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07361|    From 1 To 78 E-value: 2e-39 Score: 152
        MFTSKKSMLLFFFLGTISLSLCQEEERGADEDEVVEEEVKRGLLSVFKGVLKTAGKNVAKNVAGSLLDQLKCKISGGC
  • 2. L12A07360|    From 1 To 78 E-value: 6e-39 Score: 150
        MFTSKKSMLLFFFLGTISLSLCQEEERGADEDEVVEEEVKRGLLSVFKGVLKAAGKNVAKNVAGSLLDQLKCKISGGC
  • 3. L12A07364|    From 1 To 74 E-value: 4e-33 Score: 131
        MFTSKKSMLLLFFLGTISLSLCQEEERGADDDEVIEEEVKRGLLSVFKGVLKTAG----KHVAGSLLHQLKCKISGGC
  • 4. L12A07178|    From 1 To 78 E-value: 3e-31 Score: 125
        MFTLKKSMLLLFFLGTISLSLCQEEERGADEDEVVEEEVKRGLLSVFKGVLKTAGKNVAKNVAGSLLDQLKCKISGGC
  • 5. L12A07177|    From 1 To 78 E-value: 3e-31 Score: 125
        MFTLKKSMLLLFFLGTISLSLCQEEERGADEDEVIEEEVKRGLLSVFKGVLKTAGKNVAKNVAGSLLDQLKCKISGGC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Bacillus cereus ATCC 11778  MIC:  >50 μM  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 25923  MIC:  >50 μM  ( )  
  •   3  Target:  Escherichia coli ATCC 35218  MIC:  >50 μM  ( )  
  •   4  Target:  Pseudomonas aeruginosa ATCC 9027  MIC:  >50 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: