Record in detail


General Info

  • lamp_id:L12A007404
  • Name:
  • FullName:
  • Source:
  • Mass:5871.9 Da
  • Sequence Length:56 aa
  • Isoelectric Point:8.03
  • Activity:Antimicrobial
  • Sequence
        MGKLDDFDLDVKVKADTTKVGPAITSKSLCTPGCITGVLMCITQNSCVSCKSCIKC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07404|    From 1 To 56 E-value: 1e-26 Score: 110
        MGKLDDFDLDVKVKADTTKVGPAITSKSLCTPGCITGVLMCITQNSCVSCKSCIKC
  • 2. L12A06281|    From 1 To 56 E-value: 9e-20 Score: 87.4
        MAKLDDFDLDIVVKKQDNIVQPNITSKSLCTPGCITGILMCLTQNSCVSCNSCIRC
  • 3. L12A06271|    From 1 To 56 E-value: 4e-19 Score: 85.1
        MAKFDDFDLDIVVKKQDDVVQPNVTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC
  • 4. L02A001971    From 1 To 33 E-value: 0.000000000005 Score: 61.6
        VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC
  • 5. L12A09338|    From 1 To 41 E-value: 0.000000007 Score: 51.2
        MSKFDDFDLDVVKVSKQDSKITPQVLSKSLCTPGCITGPLQ

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  56.0 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 35218  MIC:  43.4 μM  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25325  MIC:  40.2 μM  ( )  
  •   4  Target:  Enterococcus faecalis ATCC 29212  MIC:  52.3 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: