Record in detail


General Info

  • lamp_id:L12A007582
  • Name:
  • FullName:
  • Source:
  • Mass:10002.6 Da
  • Sequence Length:90 aa
  • Isoelectric Point:7.12
  • Activity:Antimicrobial
  • Sequence
        MKAFSIAVAVTLVLAFICILESSAVPLNGVQELEEAGSNDTPVAAHQEMSMESWMMPSRVREKRQSHISMCYWCCNCCRANKGCGYCCKF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07582|    From 1 To 90 E-value: 0 Score: 188
        MKAFSIAVAVTLVLAFICILESSAVPLNGVQELEEAGSNDTPVAAHQEMSMESWMMPSRVREKRQSHISMCYWCCNCCRANKGCGYCCKF
  • 2. L12A07579|    From 1 To 90 E-value: 7.00649e-45 Score: 170
        MKAFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCRGNKGCGFCCRF
  • 3. L12A07578|    From 1 To 90 E-value: 9.80909e-45 Score: 169
        MKAFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCKSNKGCGFCCRF
  • 4. L12A08367|    From 1 To 90 E-value: 5.04467e-44 Score: 167
        MKVFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCKGNKGCGFCCRF
  • 5. L12A07586|    From 1 To 90 E-value: 8.00141e-43 Score: 163
        MKAFSIAVAVTLVLAFVCILESSAVPFPGVQELEEAGSNDTPAAAHQETSMEPWTVPSHIRQKRQSHISLCRWCCNCCKANKGCGFCCKF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus epidermidis ATCC 12228  MIC:  23 μg/ml  ( )  
  •   2  Target:  Salmonella typhi DMST 22842  MIC:  23 μg/ml  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  46 μg/ml  ( )  
  •   4  Target:  Escherichia coli ATCC 25922  MBC:  46 μg/ml  ( )  
  •   5  Target:  Staphylococcus aureus ATCC 25923  MIC:  91 μg/ml  ( )  
  •   6  Target:  Pseudomonas aeruginosa ATCC 27853  -:  NA -  ( )  
  •   7  Target:  Vibrio cholerae non-O1  MIC:  46 μg/ml  ( )  
  •   8  Target:  Vibrio cholerae non-O139  MIC:  46 μg/ml  ( )  
  •   9  Target:  Escherichia coli O157:H7  MIC:  46 μg/ml  ( )  
  •   10  Target:  Human cervical carcinoma HeLa  IC50:  28.67±0.4 μM  ( )  
  •   11  Target:  Human cervical carcinoma CaSki  IC50:  17.28±0.2 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: