Record in detail


General Info

  • lamp_id:L12A007583
  • Name:
  • FullName:
  • Source:
  • Mass:9966.6 Da
  • Sequence Length:90 aa
  • Isoelectric Point:7.64
  • Activity:Antimicrobial
  • Sequence
        MKAFSIAVAVTLVLAFICIQESSAIPVNGVTELEEAASNDTPVAARHEMSMQSWMMPNHIREKRQSHLSMCSVCCNCCKNYKGCGFCCRF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07583|    From 1 To 90 E-value: 0 Score: 187
        MKAFSIAVAVTLVLAFICIQESSAIPVNGVTELEEAASNDTPVAARHEMSMQSWMMPNHIREKRQSHLSMCSVCCNCCKNYKGCGFCCRF
  • 2. L12A07584|    From 1 To 90 E-value: 0 Score: 186
        MKAFSIAVAVTLVLAFICIQESSAIPVNGVTEVEEAASNDTPVAARHEMSMQSWMMPNHIREKRQSHLSMCSVCCNCCKNYKGCGFCCRF
  • 3. L12A07578|    From 1 To 90 E-value: 4.00001e-41 Score: 158
        MKAFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCKSNKGCGFCCRF
  • 4. L12A07579|    From 1 To 90 E-value: 9.99995e-41 Score: 157
        MKAFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCRGNKGCGFCCRF
  • 5. L12A08367|    From 1 To 90 E-value: 9.99995e-41 Score: 156
        MKVFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCKGNKGCGFCCRF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus epidermidis ATCC 12228  MIC:  23 μg/ml  ( )  
  •   2  Target:  Staphylococcus epidermidis ATCC 12228  MBC:  23 μg/ml  ( )  
  •   3  Target:  Salmonella typhi DMST 22842  MIC:  23 μg/ml  ( )  
  •   4  Target:  Salmonella typhi DMST 22842  MBC:  23 μg/ml  ( )  
  •   5  Target:  Escherichia coli ATCC 25922  MIC:  11 μg/ml  ( )  
  •   6  Target:  Staphylococcus aureus ATCC 25923  MIC:  >91 μg/ml  ( )  
  •   7  Target:  Pseudomonas aeruginosa ATCC 27853  -:  NA -  ( )  
  •   8  Target:  Vibrio cholerae non-O1  -:  NA -  ( )  
  •   9  Target:  Vibrio cholerae non-O139  -:  NA -  ( )  
  •   10  Target:  Escherichia coli ATCC 25922  MBC:  11 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: