Record in detail


General Info

  • lamp_id:L12A007775
  • Name:
  • FullName:
  • Source:
  • Mass:6052.9 Da
  • Sequence Length:56 aa
  • Isoelectric Point:8.37
  • Activity:Antimicrobial
  • Sequence
        MKAVYFVFLLVAALAYFTSNVAAACNDRDCSLDCIMKGYNTGSCVRGSCQCRRTSG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07775|    From 1 To 56 E-value: 6e-28 Score: 114
        MKAVYFVFLLVAALAYFTSNVAAACNDRDCSLDCIMKGYNTGSCVRGSCQCRRTSG
  • 2. L01A000575    From 16 To 43 E-value: 0.004 Score: 32
        NHAGCALHCVIKGYKGGQCKITVCHCRR
  • 3. L05ADEF491    From 16 To 42 E-value: 0.01 Score: 30.4
        NDSVCAAHCLVKGYKGGSCKNKICHCR
  • 4. L12A07935|    From 56 To 85 E-value: 0.016 Score: 30
        NDSACAANCLSLGKAGGHCEKGVCICRKTS
  • 5. L12A00602|    From 5 To 42 E-value: 0.018 Score: 29.6
        LASFSSQWVTP-NDSLCAAHCLVKGYRGGYCKNKICHCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus NCTC 4163  MIC:  12.5 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 25923  MIC:  12.5 μg/ml  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 6538  MIC:  12.5 μg/ml  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 29213  MIC:  12.5 μg/ml  ( )  
  •   5  Target:  Staphylococcus epidermidis ATCC 12228  MIC:  12.5 μg/ml  ( )  
  •   6  Target:  Bacillus subtilis ATCC 6633  MIC:  12.5 μg/ml  ( )  
  •   7  Target:  Bacillus cereus ATCC 11778  MIC:  50 μg/ml  ( )  
  •   8  Target:  Enterococcus hirae ATCC 10541  MIC:  100 μg/ml  ( )  
  •   9  Target:  Micrococcus luteus ATCC 10240  MIC:  12.5 μg/ml  ( )  
  •   10  Target:  Micrococcus luteus ATCC 9341  MIC:  6.25 μg/ml  ( )  
  •   11  Target:  Candida albicans ATCC 10231  MIC:  100 μg/ml  ( )  
  •   12  Target:  Candida albicans ATCC 90028  MIC:  100 μg/ml  ( )  
  •   13  Target:  Candida albicans SN250  MIC:  15.62 μg/ml  ( )  
  •   14  Target:  Candida parapsilosis ATCC 22019  MIC:  100 μg/ml  ( )  
  •   15  Target:  Escherichia coli ATCC 10538  -:  NA -  ( )  
  •   16  Target:  Escherichia coli ATCC 25922  -:  NA -  ( )  
  •   17  Target:  Escherichia coli NCTC 8196  -:  NA -  ( )  
  •   18  Target:  Proteus vulgaris NCTC 4635  -:  NA -  ( )  
  •   19  Target:  Pseudomonas aeruginosa ATCC 15442  -:  NA -  ( )  
  •   20  Target:  Pseudomonas aeruginosa NCTC 6749  -:  NA -  ( )  
  •   21  Target:  Pseudomonas aeruginosa ATCC 27853  -:  NA -  ( )  
  •   22  Target:  Bordetella bronchiseptica ATCC 4617  -:  NA -  ( )  
  •   23  Target:  Human lung carcinoma A549  IC50:  0.08±0.04 μM  ( )  
  •   24  Target:  Human breast adenocarcinoma MCF-7  IC50:  0.46±0.09 μM  ( )  
  •   25  Target:  Human colon adenocarcinoma LoVo  IC50:  0.06±0.01 μM  ( )  
  •   26  Target:  Human cervical carcinoma HeLa-KB  IC50:  0.42±0.11 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: