Record in detail


General Info

  • lamp_id:L12A007945
  • Name:
  • FullName:
  • Source:
  • Mass:5828.6 Da
  • Sequence Length:52 aa
  • Isoelectric Point:10.11
  • Activity:Antibacterial
  • Sequence
        MKKFKELKENELTAITGGSFVGYYLGRFLASATHYYGKTVTKGHMHSSTINN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_07945

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07945|    From 1 To 52 E-value: 2e-25 Score: 105
        MKKFKELKENELTAITGGSFVGYYLGRFLASATHYYGKTVTKGHMHSSTINN
  • 2. L12A07946|    From 1 To 23 E-value: 0.021 Score: 29.6
        MKKFLVLRDRELNAISGGVFHAY
  • 3. L12A07802|    From 1 To 49 E-value: 0.048 Score: 28.5
        MKELSEKELRECVGGSIWG-DIGQGVGKAAYWVGKAM--GNMSDVNQASRIN
  • 4. L12A06737|    From 1 To 22 E-value: 0.065 Score: 27.7
        MEKFIELSLKEVTAITGGKYYG
  • 5. L12A06736|    From 1 To 22 E-value: 0.069 Score: 27.7
        MEKFIELSLKEVTAITGGKYYG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Xanthomonas axonopodis pv. vesicatoria 2133-2  MIC:  <1.25 μM  ( )  
  •   2  Target:  Pseudomonas syringae pv. syringae EPS 94  MIC:  2.5-5.0 μM  ( )  
  •   3  Target:  Erwinia amylovora PMV 6076  MIC:  2.5-5.0 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: