Record in detail


General Info

  • lamp_id:L12A008016
  • Name:
  • FullName:
  • Source:
  • Mass:6337.5 Da
  • Sequence Length:63 aa
  • Isoelectric Point:10.79
  • Activity:Antibacterial
  • Sequence
        MKLIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_08016

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08016|    From 1 To 63 E-value: 6e-29 Score: 117
        MKLIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
  • 2. L02A001652    From 1 To 61 E-value: 1e-27 Score: 113
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
  • 3. L13A010829    From 1 To 50 E-value: 1e-21 Score: 93.2
        LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIV
  • 4. L04ABAC209    From 1 To 63 E-value: 1e-19 Score: 86.7
        MFLVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWATKAALATAETIVKHEGKAAAIAW
  • 5. L12A06081|    From 1 To 61 E-value: 3e-19 Score: 85.9
        LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  -:  NA -  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 15442  -:  NA -  ( )  
  •   3  Target:  Bacillus subtilis CCT 2576  -:  NA -  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 6538  -:  NA -  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: