Record in detail


General Info

  • lamp_id:L12A008070
  • Name:
  • FullName:
  • Source:
  • Mass:7827.5 Da
  • Sequence Length:67 aa
  • Isoelectric Point:10.43
  • Activity:Antimicrobial
  • Sequence
        MKLLSLILAGLLLLSQLTPGGTRKCWNFHGKCRHKCFKKEKVYVYCTNNKLCCVKSRYLPKNLPWQI
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08070|    From 1 To 67 E-value: 1e-34 Score: 137
        MKLLSLILAGLLLLSQLTPGGTRKCWNFHGKCRHKCFKKEKVYVYCTNNKLCCVKSRYLPKNLPWQI
  • 2. L12A08072|    From 1 To 67 E-value: 2e-34 Score: 136
        MKLLSLILAGLLLLSQLTPGGTRKCWNFHGRCRHKCFKKEKVYVYCTNNKLCCVKSRYLPKNLPWQI
  • 3. L12A02765|    From 1 To 48 E-value: 1e-24 Score: 103
        GGTRKCWNFHGKCRHKCFKKEKVYVYCTNNKLCCVKSRYLPKNLPWQI
  • 4. L12A08069|    From 18 To 67 E-value: 5e-24 Score: 101
        TPGGSLKCWNYHGKCRHKCFKKEKVYVYCTNNKLCCVKSRFLPKNLPWQI
  • 5. L12A09099|    From 1 To 65 E-value: 1e-20 Score: 90.1
        MRLLLLTLAVLLLLSQFTPGHTQKCWNLHGKCRHQCFKKEKIYVYCTNNKFCCVKPKYQPKRKPW

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli  MIC:  4-8 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus  MIC:  4-8 μg/ml  ( )  
  •   3  Target:  Escherichia coli KCTC 1682  MIC:  7.5 μM  ( )  
  •   4  Target:  Salmonella typhimurium KCTC 1926  MIC:  15 μM  ( )  
  •   5  Target:  Pseudomonas aeruginosa KCTC 1637  MIC:  15 μM  ( )  
  •   6  Target:  Staphylococcus aureus KCTC 1621  MIC:  15 μM  ( )  
  •   7  Target:  Staphylococcus epidermidis KCTC 1917  MIC:  7.5 μM  ( )  
  •   8  Target:  Bacillus subtilis KCTC 3068  MIC:  15 μM  ( )  
  •   9  Target:  Enterococcus faecium  MIC:  7.5 μM  ( )  
  •   10  Target:  Enterococcus faecalis  MIC:  3.8 μM  ( )  
  •   11  Target:  Enterococcus faecium VR  MIC:  7.5 μM  ( )  
  •   12  Target:  Enterococcus faecalis VR  MIC:  7.5 μM  ( )  
  •   13  Target:  Staphylococcus aureus MR  MIC:  15 μM  ( )  
  •   14  Target:  Enterococcus faecium KCCM 12118  MIC:  8 μg/ml  ( )  
  •   15  Target:  Enterococcus faecalis KCCM 29212  MIC:  2 μg/ml  ( )  
  •   16  Target:  Enterococcus faecium ATCC 51559  MIC:  4 μg/ml  ( )  
  •   17  Target:  Enterococcus faecalis ATCC 51575  MIC:  2 μg/ml  ( )  
  •   18  Target:  Staphylococcus aureus KCCM 40510  MIC:  16 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: