Record in detail


General Info

  • lamp_id:L12A008144
  • Name:
  • FullName:
  • Source:
  • Mass:9587 Da
  • Sequence Length:93 aa
  • Isoelectric Point:12.37
  • Activity:Antimicrobial
  • Sequence
        MKMKVQVRSLILLAVAVLQVRSRRSKVRICSRGKNCVSRLGGGSIIGRPGGGSLIGRPGGGSVIGRPGGGSPPGGGSFNDEFIRDHSDGNRFA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08144|    From 1 To 93 E-value: 0 Score: 176
        MKMKVQVRSLILLAVAVLQVRSRRSKVRICSRGKNCVSRLGGGSIIGRPGGGSLIGRPGGGSVIGRPGGGSPPGGGSFNDEFIRDHSDGNRFA
  • 2. L12A10733|    From 1 To 71 E-value: 5e-34 Score: 134
        RRSKVRICSRGKNCVSRLGGGSIIGRPGGGSLIGRPGGGSVIGRPGGGSPPGGGSFNDEFIRDHSDGNRFA
  • 3. L12A08143|    From 1 To 54 E-value: 2e-21 Score: 92.8
        MKMKVQVRSLILLAVAVLQVRSRRSKVRICSRGKNCV---------------------------------------SFNDEFIRDHSDGNRFA
  • 4. L12A10471|    From 1 To 66 E-value: 4e-21 Score: 91.7
        RICSRGKNCVSRPGVGSIIGRPGGGSLIGRPGGGSVIGRPGGGSPPGGGSFNDEFIRDHSDGNRFA
  • 5. L02A000693    From 1 To 66 E-value: 1e-20 Score: 89.7
        RICSRDKNCVSRPGVGSIIGRPGGGSLIGRPGGGSVIGRPGGGSPPGGGSFNDEFIRDHSDGNRFA

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 33591  MIC:  >512 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 25923  MIC:  >512 μg/ml  ( )  
  •   3  Target:  Staphylococcus epidermidis ATCC 35984  MIC:  >512 μg/ml  ( )  
  •   4  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  256-512 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: