Record in detail


General Info

  • lamp_id:L12A008168
  • Name:
  • FullName:
  • Source:
  • Mass:5213.9 Da
  • Sequence Length:48 aa
  • Isoelectric Point:4.29
  • Activity:Antibacterial
  • Sequence
        MKNSKDILNNAIEEVSEKELMEVAGGKRGPGWIATITDDCPNSVFVCC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_08168

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08168|    From 1 To 48 E-value: 9e-24 Score: 100
        MKNSKDILNNAIEEVSEKELMEVAGGKRGPGWIATITDDCPNSVFVCC
  • 2. L12A08167|    From 1 To 48 E-value: 1e-23 Score: 100
        MKNSKDILNNAIEEVSEKELMEVAGGKRGPGWIATITDDCPNSIFVCC
  • 3. L12A08172|    From 1 To 48 E-value: 5e-23 Score: 97.8
        MKNSKDVLNNAIEEVSEKELMEVAGGKKGPGWIATITDDCPNSIFVCC
  • 4. L12A08169|    From 1 To 48 E-value: 5e-23 Score: 97.8
        MKNSKDILNNAIEEVSEKELMEVAGGKRGSGWIATITDDCPNSVFVCC
  • 5. L12A08170|    From 1 To 48 E-value: 1e-22 Score: 96.3
        MKNSKDILNNAIEEVSEKELMEVAGGKRGTGWFATITDDCPNSVFVCC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  -:  NA -  ( )  
  •   2  Target:  Bacillus cereus ATCC 11778  -:  NA -  ( )  
  •   3  Target:  Pseudomonas aeruginosa ATCC 9027  -:  NA -  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 25923  EC50:  101 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: