Record in detail


General Info

  • lamp_id:L12A008190
  • Name:
  • FullName:
  • Source:
  • Mass:8880.4 Da
  • Sequence Length:81 aa
  • Isoelectric Point:8.05
  • Activity:Antimicrobial
  • Sequence
        MKPVPICCLLLLLSFICHRGHSASLSGNEVTVTGNQIPETQMEESNALEPLLRSKRQSHLSICVHCCNCCKYKGCGKCCLT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08190|    From 1 To 81 E-value: 1.00053e-42 Score: 162
        MKPVPICCLLLLLSFICHRGHSASLSGNEVTVTGNQIPETQMEESNALEPLLRSKRQSHLSICVHCCNCCKYKGCGKCCLT
  • 2. L12A08220|    From 16 To 63 E-value: 0.00000000002 Score: 59.7
        ICHRGHSASLSGNEIKAPEHPISESEQGESDALGPLFRTKR--HLNICVY
  • 3. L12A07594|    From 10 To 88 E-value: 0.000000003 Score: 52.4
        VTLVLAFICMPESSAVPFTGVQELEEAGSNDTPVAAYQEMSMESKMMPDHIRQKRQSHLSLCRWCCNCCRAYKGCGFCC
  • 4. L12A01558|    From 1 To 40 E-value: 0.000000004 Score: 52
        ETTPEQSNPL-ALFRSKRQSHLSMCRYCCKCCRNKGCGFCC
  • 5. L12A07595|    From 10 To 88 E-value: 0.000000004 Score: 51.6
        VTLVLAFVCMPESSAVPFTGVQELEEAGSNDTPVAAYQEMSMESKMMPDHIRQKRQSHLSLCRWCCNCCRAYKGCGFCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli D31  MIC:  >100 μM  ( )  
  •   2  Target:  Micrococcus luteus DSM 20030  MIC:  >100 μM  ( )  
  •   3  Target:  Staphylococcus aureus DSM 2569  -:  NA -  ( )  
  •   4  Target:  Staphylococcus epidermidis DSM 3269  -:  NA -  ( )  
  •   5  Target:  Pseudomonas aeruginosa DSM 50071  -:  NA -  ( )  
  •   6  Target:  Fusarium graminearum IFA 65  MIC:  5.0 μM  ( )  
  •   7  Target:  Fusarium graminearum IFA 65  IC50:  2.2 μM  ( )  
  •   8  Target:  Phytophthora parasitica  MIC:  50 μM  ( )  
  •   9  Target:  Phytophthora parasitica  IC50:  35 μM  ( )  
  •   10  Target:  Rhizopus oryzae ATCC 56536  -:  NA -  ( )  
  •   11  Target:  Arthoderma benhamiae CBS 112371  -:  NA -  ( )  
  •   12  Target:  Aspergillus fumigatus ATCC 46645  -:  NA -  ( )  
  •   13  Target:  Aspergillus terreus FSU 6307  -:  NA -  ( )  
  •   14  Target:  Lichtheimia corymbifera FSU 9682  MIC:  15 μM  ( )  
  •   15  Target:  Mucor circinelloides FSU 5859  MIC:  60 μM  ( )  
  •   16  Target:  Candida albicans SC5314  MIC:  30 μM  ( )  
  •   17  Target:  Cladosporium herbarum FSU 3771  MIC:  60 μM  ( )  
  •   18  Target:  Alternaria alternata FSU 9317  MIC:  60 μM  ( )  
  •   19  Target:  Trichosporon asahii FSU 11372  MIC:  30 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: