Record in detail


General Info

  • lamp_id:L12A008194
  • Name:
  • FullName:
  • Source:
  • Mass:7171.5 Da
  • Sequence Length:71 aa
  • Isoelectric Point:4.44
  • Activity:Antibacterial
  • Sequence
        MKQSIIIALFATIAVMACLQMVAAVPAPVPEAAPGPVAEAEAYASPEALASPEAEPILGIITSLLKSLGKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_08194

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08194|    From 1 To 71 E-value: 2e-33 Score: 132
        MKQSIIIALFATIAVMACLQMVAAVPAPVPEAAPGPVAEAEAYASPEALASPEAEPILGIITSLLKSLGKK
  • 2. L12A09463|    From 3 To 68 E-value: 0.000000000000001 Score: 73.6
        KQSIVIVLFAAIAMMACLQRVTAEPAPEPIAAPI----AEPYANPEAIASPEAKDLHTVVSAILQALGKK
  • 3. L12A08195|    From 1 To 79 E-value: 0.000000000000001 Score: 73.6
        MKQTIVIVLLAAVAMMACLQMVAAEPLPEAAPAPSPLAEAEALASPIAEALANPEALASPEAGRILSFIKGLAEHLGKK
  • 4. L12A08404|    From 1 To 65 E-value: 0.0000003 Score: 45.8
        MKYNIVF-LFAIIASLACLQLTFAAPAASPLANPG--------ASPDAAPNADPLADPFLPIIGKLLSGLLGKK
  • 5. L02A001680    From 1 To 15 E-value: 0.022 Score: 29.6
        ILGIITSLLKSLGKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli D31  MIC:  >100 μM  ( )  
  •   2  Target:  Micrococcus luteus DSM 20030  MIC:  >100 μM  ( )  
  •   3  Target:  Comamonas terrigena ATCC 8461  -:  NA -  ( )  
  •   4  Target:  Enterobacter aerogenes SG117  -:  NA -  ( )  
  •   5  Target:  Escherichia coli DC2  -:  NA -  ( )  
  •   6  Target:  Escherichia coli DC0  -:  NA -  ( )  
  •   7  Target:  Escherichia coli SG458  -:  NA -  ( )  
  •   8  Target:  Proteus vulgaris OX19  -:  NA -  ( )  
  •   9  Target:  Morganella morganii SG464  -:  NA -  ( )  
  •   10  Target:  Serratia marcescens SG621  -:  NA -  ( )  
  •   11  Target:  Pseudomonas aeruginosa K799  -:  NA -  ( )  
  •   12  Target:  Pseudomonas aeruginosa SG137  -:  NA -  ( )  
  •   13  Target:  Pseudomonas aeruginosa ATCC 27853  -:  NA -  ( )  
  •   14  Target:  Pseudomonas aeruginosa ATCC 9027  -:  NA -  ( )  
  •   15  Target:  Pseudomonas aeruginosa NCTC 10701  -:  NA -  ( )  
  •   16  Target:  Salmonella gallinarum ATCC 9184  -:  NA -  ( )  
  •   17  Target:  Proteus mirabilis SG654  -:  NA -  ( )  
  •   18  Target:  Enterococcus faecalis 1528  -:  NA -  ( )  
  •   19  Target:  Staphylococcus aureus 511  -:  NA -  ( )  
  •   20  Target:  Staphylococcus aureus 134/39  -:  NA -  ( )  
  •   21  Target:  Mycobacterium smegmatis 987  -:  NA -  ( )  
  •   22  Target:  Penicillium notatum JP36  -:  NA -  ( )  
  •   23  Target:  Candida albicans  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: