Record in detail


General Info

  • lamp_id:L12A008385
  • Name:
  • FullName:
  • Source:
  • Mass:5903 Da
  • Sequence Length:53 aa
  • Isoelectric Point:10.72
  • Activity:Antibacterial
  • Sequence
        MKVVIFIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_08385

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06220|    From 9 To 61 E-value: 6e-26 Score: 107
        MKVVIFIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 2. L12A08385|    From 1 To 53 E-value: 1e-25 Score: 106
        MKVVIFIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 3. L12A08383|    From 1 To 53 E-value: 2e-25 Score: 106
        MKVVIFIFALLATICAAFAYVPLPNIPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 4. L12A08388|    From 1 To 53 E-value: 2e-25 Score: 105
        MKVVIFIFALLATVCAAFAYVPLPNIPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 5. L12A08384|    From 1 To 53 E-value: 3e-25 Score: 105
        MKVVIFIFALLATICAAFAYVPLPNIPQPGRRPFPTFPGQGPFNPKIRWPQGY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human lung carcinoma A549  IC50:  >83.6 μM  ( )  
  •   2  Target:  Human melanoma A375  IC50:  >83.6 μM  ( )  
  •   3  Target:  Human breast adenocarcinoma MCF-7  IC50:  >83.6 μM  ( )  
  •   4  Target:  Human colon adenocarcinoma SW1116  IC50:  >83.6 μM  ( )  
  •   5  Target:  Human rhabdomyosarcoma  IC50:  >83.6 μM  ( )  
  •   6  Target:  Human lung carcinoma H1299  IC50:  37.7±0.10 μM  ( )  
  •   7  Target:  Mouse skin melanoma B16  IC50:  >83.6 μM  ( )  
  •   8  Target:  Human cervical carcinoma HeLa  IC50:  >83.6 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: