Record in detail


General Info

  • lamp_id:L12A008388
  • Name:
  • FullName:
  • Source:
  • Mass:5903 Da
  • Sequence Length:53 aa
  • Isoelectric Point:10.72
  • Activity:Antimicrobial
  • Sequence
        MKVVIFIFALLATVCAAFAYVPLPNIPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08388|    From 1 To 53 E-value: 1e-25 Score: 106
        MKVVIFIFALLATVCAAFAYVPLPNIPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 2. L12A06220|    From 9 To 61 E-value: 1e-25 Score: 106
        MKVVIFIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 3. L12A08383|    From 1 To 53 E-value: 2e-25 Score: 106
        MKVVIFIFALLATICAAFAYVPLPNIPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 4. L12A08385|    From 1 To 53 E-value: 2e-25 Score: 105
        MKVVIFIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
  • 5. L12A08384|    From 1 To 53 E-value: 3e-25 Score: 105
        MKVVIFIFALLATICAAFAYVPLPNIPQPGRRPFPTFPGQGPFNPKIRWPQGY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli DH5alpha  MIC:  128 μM  ( )  
  •   2  Target:  Enterobacter helveticus DSM 18396  MIC:  128 μM  ( )  
  •   3  Target:  Kocuria rhizophila DSM 348  MIC:  >256 μM  ( )  
  •   4  Target:  Bacillus subtilis DSM 347  MIC:  32 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: