Record in detail


General Info

  • lamp_id:L12A008515
  • Name:
  • FullName:
  • Source:
  • Mass:7571.6 Da
  • Sequence Length:68 aa
  • Isoelectric Point:3.88
  • Activity:Antibacterial
  • Sequence
        MNDILETETPVMVSPRWDMLLDAGEDTSPSVQTQIDAEFRRVVSPYMSSSGWLCTLTIECGTIICACR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_08515

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08515|    From 1 To 68 E-value: 7e-36 Score: 140
        MNDILETETPVMVSPRWDMLLDAGEDTSPSVQTQIDAEFRRVVSPYMSSSGWLCTLTIECGTIICACR
  • 2. L12A09280|    From 35 To 64 E-value: 0.0000003 Score: 45.8
        DLREDRTIYAASSGWVCTLTIECGTVICAC
  • 3. L01A003460    From 1 To 21 E-value: 0.0000004 Score: 45.4
        SSSGWLCTLTIECGTIICACR
  • 4. L12A00066|    From 2 To 22 E-value: 0.000002 Score: 43.1
        ASSGWVCTLTIECGTVICACR
  • 5. L13A011450    From 1 To 21 E-value: 0.000002 Score: 42.7
        ASSGWVCTLTIECGTVICACR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  8 μM  ( )  
  •   2  Target:  Escherichia coli BW25113  MIC:  8 μM  ( )  
  •   3  Target:  Escherichia coli BW25113 del-waaG  MIC:  4 μM  ( )  
  •   4  Target:  Escherichia coli BW25113 del-sbmA  MIC:  32 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: