Record in detail


General Info

  • lamp_id:L12A008772
  • Name:
  • FullName:
  • Source:
  • Mass:6743.8 Da
  • Sequence Length:63 aa
  • Isoelectric Point:10.68
  • Activity:Antimicrobial
  • Sequence
        MNFYKIFVFVALILAISVGESEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAANVAATARG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08772|    From 1 To 63 E-value: 1e-31 Score: 126
        MNFYKIFVFVALILAISVGESEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAANVAATARG
  • 2. L12A08769|    From 1 To 63 E-value: 3e-30 Score: 121
        MNFYKIFVFIALILAIAIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG
  • 3. L03A000226    From 1 To 63 E-value: 4e-30 Score: 121
        MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG
  • 4. L03A000228    From 1 To 63 E-value: 6e-30 Score: 120
        MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG
  • 5. L12A08773|    From 1 To 63 E-value: 9e-29 Score: 117
        MNFYKIFVFVALILAISVGQSEAGWLKKLGKRLERVGQHTRDATIQVVGIAQQAANVAATARG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  37.50 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 2592  MIC:  >100 μg/ml  ( )  
  •   3  Target:  Bacillus subtilis  MIC:  >100 μg/ml  ( )  
  •   4  Target:  Candida albicans ATCC 2002  MIC:  9.38 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: