Record in detail


General Info

  • lamp_id:L12A008828
  • Name:
  • FullName:
  • Source:
  • Mass:5219 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.9
  • Activity:Antibacterial
  • Sequence
        MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08828|    From 1 To 46 E-value: 3e-22 Score: 95.9
        MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK
  • 2. L02A000673    From 1 To 23 E-value: 0.000000007 Score: 50.8
        VGSRYLCTPGSCWKLVCFTTTVK
  • 3. L04ABAC021    From 1 To 22 E-value: 0.00000002 Score: 49.3
        GSRYLCTPGSCWKLVCFTTTVK
  • 4. L12A06691|    From 11 To 49 E-value: 0.0003 Score: 35.8
        FDLDVKVNAKESNDSGAEPRIASKFLCTPG-CAKTGSFNS
  • 5. L12A06690|    From 11 To 49 E-value: 0.002 Score: 33.1
        FNLDVKVNAKESNDSGAEPRIASKFICTPG-CAKTGSFNS

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MBC:  8 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 25922  MBC:  4 μM  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MBC:  64 μM  ( )  
  •   4  Target:  Escherichia coli ATCC 25922  MBC:  4 μM  ( )  
  •   5  Target:  Escherichia coli UB1005  MBC:  32 μM  ( )  
  •   6  Target:  Salmonella typhimurium ATCC 14028  MBC:  128 μM  ( )  
  •   7  Target:  Staphylococcus aureus ATCC 29213  MBC:  32 μM  ( )  
  •   8  Target:  Staphylococcus aureus ATCC 29213  MBC:  128 μM  ( )  
  •   9  Target:  Staphylococcus aureus ATCC 43300  MBC:  32 μM  ( )  
  •   10  Target:  Staphylococcus epidermidis ATCC 12228  MBC:  32 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: