Record in detail


General Info

  • lamp_id:L12A008940
  • Name:
  • FullName:
  • Source:
  • Mass:10119.4 Da
  • Sequence Length:92 aa
  • Isoelectric Point:7.85
  • Activity:Antibacterial
  • Sequence
        MQITSIAIVFFAAMGAVANPIARESDDLDARDVQLSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_08940

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08940|    From 1 To 92 E-value: 0 Score: 194
        MQITSIAIVFFAAMGAVANPIARESDDLDARDVQLSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
  • 2. L02A001562    From 1 To 58 E-value: 7e-31 Score: 124
        LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
  • 3. L11A011936    From 1 To 58 E-value: 3e-28 Score: 115
        LSKYGGQCSLKHNTCTYLKGGRNVIVNCGSAANKRCKSDRHHCEYDEHHRRVDCQTPV
  • 4. L11A006646    From 1 To 58 E-value: 2e-25 Score: 105
        LSKYGGECSVEHNTCTYLKGGKDHIVSCPSAANLRCKTERHHCEYDEHHKTVDCQTPV
  • 5. L02A001561    From 1 To 57 E-value: 1e-24 Score: 103
        SKYGGECSVEHNTCTYLKGGKDHIVSCPSAANLRCKTERHHCEYDEHHKTVDCQTPV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  >256 μg/ml  ( )  
  •   2  Target:  Salmonella enterica serovar Typhimurium C77-31  MIC:  >256 μg/ml  ( )  
  •   3  Target:  Bacillus subtilis CMCC 63501  MIC:  8 μg/ml  ( )  
  •   4  Target:  Staphylococcus epidermidis ATCC 12228  MIC:  16 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: