Record in detail


General Info

  • lamp_id:L12A008991
  • Name:
  • FullName:
  • Source:
  • Mass:8405.9 Da
  • Sequence Length:73 aa
  • Isoelectric Point:9.9
  • Activity:Antimicrobial
  • Sequence
        MQYKTFLVIFLAYLLVTEEALAFWGALAKGALKLIPSLVSSFTKKDKRALKNIFDPYQKNLDLELERLLSQLQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08991|    From 1 To 73 E-value: 3e-37 Score: 145
        MQYKTFLVIFLAYLLVTEEALAFWGALAKGALKLIPSLVSSFTKKDKRALKNIFDPYQKNLDLELERLLSQLQ
  • 2. L13A015576    From 1 To 24 E-value: 0.00000001 Score: 50.4
        FWGALAKGALKLIPSLVSSFTKKD
  • 3. L01A000319    From 1 To 24 E-value: 0.0000001 Score: 47
        FWGALAKGALKLIPSLFSSFSKKD
  • 4. L11A011222    From 1 To 21 E-value: 0.0000006 Score: 44.7
        FWGALAKGALKLIPSLVSSFT
  • 5. L12A02394|    From 1 To 24 E-value: 0.000001 Score: 43.5
        FWGALAKGALKLIGSLFSSFSKKD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  -:  NA -  ( )  
  •   2  Target:  Bacillus subtilis  -:  NA -  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  -:  NA -  ( )  
  •   4  Target:  Candida albicans ATCC 2002  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: