Record in detail


General Info

  • lamp_id:L12A008992
  • Name:
  • FullName:
  • Source:
  • Mass:7781.4 Da
  • Sequence Length:71 aa
  • Isoelectric Point:8.04
  • Activity:Antimicrobial
  • Sequence
        MQYVFLKFIVLLIPICTPFGLTIVVQNEAASFPFSCPTLSGVCRKVCLPTEMFFGPLGCGKGFLCCVSHFL
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08992|    From 1 To 71 E-value: 6e-36 Score: 140
        MQYVFLKFIVLLIPICTPFGLTIVVQNEAASFPFSCPTLSGVCRKVCLPTEMFFGPLGCGKGFLCCVSHFL
  • 2. L12A01472|    From 1 To 46 E-value: 5e-21 Score: 91.7
        ENEAVSFPWSCPTLSGVCRKVCLPTEMFFGPLGCGKGFLCCVSHFL
  • 3. L01A002400    From 16 To 60 E-value: 1e-20 Score: 90.1
        EDEAASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF
  • 4. L12A00551|    From 1 To 41 E-value: 2e-18 Score: 83.2
        ASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF
  • 5. L12A00559|    From 1 To 42 E-value: 6e-18 Score: 81.3
        ASFPWTCPSLSGVCRKVCLPTEMFFGPLGCGKGFQCCVSHFL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  -:  NA -  ( )  
  •   2  Target:  Bacillus subtilis  -:  NA -  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  -:  NA -  ( )  
  •   4  Target:  Candida albicans ATCC 2002  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: