Record in detail


General Info

  • lamp_id:L12A008993
  • Name:
  • FullName:
  • Source:
  • Mass:4810.6 Da
  • Sequence Length:39 aa
  • Isoelectric Point:9.1
  • Activity:Antimicrobial
  • Sequence
        MQYWTCGYRGLCRRFCYAQEYIVGHHGCPRRYRCCAVRF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08993|    From 1 To 39 E-value: 5e-18 Score: 81.6
        MQYWTCGYRGLCRRFCYAQEYIVGHHGCPRRYRCCAVRF
  • 2. L12A01316|    From 7 To 45 E-value: 7e-18 Score: 80.9
        MQYWTCGYRGLCRRFCYAQEYIIGHHGCPRRYRCCAMRF
  • 3. L12A09669|    From 5 To 42 E-value: 3e-17 Score: 79
        MQYWTCGYRGLCRRFCHAQEYIVGHHGCPRRYRCCAVR
  • 4. L12A01013|    From 5 To 43 E-value: 0.00000000000007 Score: 67.8
        VQGWTCGYRGACRKYCYAQEYMVGYHGCPRRLRCCALRF
  • 5. L12A12182|    From 5 To 43 E-value: 0.0000000000002 Score: 66.2
        IQGWTCGSRGLCRKHCYAQEHTVGYHGCPRRYRCCALRF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  -:  NA -  ( )  
  •   2  Target:  Bacillus subtilis  -:  NA -  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  -:  NA -  ( )  
  •   4  Target:  Candida albicans ATCC 2002  -:  NA -  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: