Record in detail


General Info

  • lamp_id:L12A008995
  • Name:
  • FullName:
  • Source:
  • Mass:9557.2 Da
  • Sequence Length:88 aa
  • Isoelectric Point:7.62
  • Activity:Antimicrobial
  • Sequence
        MRAFSIAVAVTLVLAFVCFVEALPFAGVPEPEEAGSNDTPVAAYPDMLAQSLMMPGHVREKRQSHLSMCRWCCNCCRGNKGCGPCCKF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08995|    From 1 To 88 E-value: 0 Score: 183
        MRAFSIAVAVTLVLAFVCFVEALPFAGVPEPEEAGSNDTPVAAYPDMLAQSLMMPGHVREKRQSHLSMCRWCCNCCRGNKGCGPCCKF
  • 2. L12A07575|    From 1 To 90 E-value: 4e-37 Score: 145
        MKAFSIAVAVTLVLAFICILESSAVPFTGVQELEEAASNDTPVAAYQEMSMESRMMPDHVRQKRQSHLSLCRWCCNCCRGNKGCGFCCKF
  • 3. L12A07585|    From 1 To 90 E-value: 5e-37 Score: 144
        MKAFSIAVAVTLVLAFICMLESSAIPFAGVQEPEEAGSNDTPVVAHQEMSAESSMMSNHIRQKRQSHLSLCRWCCNCCRSNKGCGFCCRF
  • 4. L12A07579|    From 1 To 90 E-value: 7e-37 Score: 144
        MKAFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCRGNKGCGFCCRF
  • 5. L12A08367|    From 1 To 90 E-value: 4e-36 Score: 141
        MKVFSIAVAVTLVLAFICILESSAVPFTGVQELEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSLCRWCCNCCKGNKGCGFCCRF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 9144  MIC:  6.25 μM  ( )  
  •   2  Target:  Bacillus subtilis ATCC 6633  MIC:  10.5 μM  ( )  
  •   3  Target:  Staphylococcus epidermidis NRRL B-4268  MIC:  12.1 μM  ( )  
  •   4  Target:  Staphylococcus aureus MR  MIC:  6.25 μM  ( )  
  •   5  Target:  Escherichia coli ATCC 10536  MIC:  6.25 μM  ( )  
  •   6  Target:  Pseudomonas aeruginosa ATCC BAA-427  MIC:  11.2 μM  ( )  
  •   7  Target:  Klebsiella pneumoniae ATCC 27736  MIC:  6.2 μM  ( )  
  •   8  Target:  Candida albicans  MIC:  3.1 μM  ( )  
  •   9  Target:  Cryptococcus neoformans  MIC:  6.1 μM  ( )  
  •   10  Target:  Candida parapsilosis ATCC 22019  MIC:  3.0 μM  ( )  
  •   11  Target:  Sporothrix schenckii  MIC:  1.56 μM  ( )  
  •   12  Target:  Trichophyton mentagrophytes  MIC:  1.56 μM  ( )  
  •   13  Target:  Aspergillus fumigatus  MIC:  3.1 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: