Record in detail


General Info

  • lamp_id:L12A009005
  • Name:
  • FullName:
  • Source:
  • Mass:7663.1 Da
  • Sequence Length:67 aa
  • Isoelectric Point:8.56
  • Activity:Antimicrobial
  • Sequence
        MRCIALFLVLSLVVLMAEPGEGFIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09005|    From 1 To 67 E-value: 7e-34 Score: 134
        MRCIALFLVLSLVVLMAEPGEGFIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
  • 2. L12A09004|    From 1 To 68 E-value: 1e-22 Score: 96.7
        MRCIALFLVLSLVVLMAEPGEGFFFHIIKGLFHAGRMIHGLVNRRRHRHGMEEL-DLDQRAFEREKAFA
  • 3. L11A009705    From 1 To 45 E-value: 3e-21 Score: 92
        FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
  • 4. L12A10348|    From 1 To 41 E-value: 6e-17 Score: 77.8
        RCIALFFVLSLVVLMAEPGEGFFFHIIKGLFHAGKMIHGLI
  • 5. L12A10349|    From 1 To 41 E-value: 6e-17 Score: 77.8
        RCIALFLVLSLVALMAEPGEGFIFHIIKGLVHAGKMIHGLV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  6.0±0.8 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 25922  MIC:  20±2.5 μM  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  MIC:  2.5±0.4 μM  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 25923  MIC:  18±2.0 μM  ( )  
  •   5  Target:  Pseudomonas aeruginosa ATCC BAA-427  MIC:  12.0±1.6 μM  ( )  
  •   6  Target:  Klebsiella pneumoniae ATCC 27736  MIC:  8.0±1.1 μM  ( )  
  •   7  Target:  Bacillus subtilis ATCC 6633  MIC:  8.0±1.1 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: