Record in detail


General Info

  • lamp_id:L12A009008
  • Name:
  • FullName:
  • Source:
  • Mass:7908.7 Da
  • Sequence Length:77 aa
  • Isoelectric Point:4.11
  • Activity:Antibacterial
  • Sequence
        MREISDNMLDSVKGGMNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYSMSSSTSSANSGS
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09008

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09008|    From 1 To 77 E-value: 2e-39 Score: 152
        MREISDNMLDSVKGGMNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYSMSSSTSSANSGS
  • 2. L01A002809    From 1 To 62 E-value: 1e-30 Score: 123
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYSMSSSTSSANSGS
  • 3. L13A023575    From 1 To 50 E-value: 4e-25 Score: 105
        MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYS
  • 4. L12A06533|    From 31 To 48 E-value: 8.8 Score: 20.8
        GLYCKSNGGCWVDWSQTI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  5.0±0.7 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 25922  MIC:  20±2.5 μM  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  MIC:  2.0±0.4 μM  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 25923  MIC:  18±2.0 μM  ( )  
  •   5  Target:  Pseudomonas aeruginosa ATCC BAA-427  MIC:  12.0±1.6 μM  ( )  
  •   6  Target:  Klebsiella pneumoniae ATCC 27736  MIC:  6.0±0.8 μM  ( )  
  •   7  Target:  Bacillus subtilis ATCC 6633  MIC:  8.0±1.1 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: