Record in detail


General Info

  • lamp_id:L12A009038
  • Name:
  • FullName:
  • Source:
  • Mass:7171.3 Da
  • Sequence Length:61 aa
  • Isoelectric Point:8.4
  • Activity:Antimicrobial
  • Sequence
        MRILQLLFEVIVILLLQDVPEARGLSDSQQCRSNHGHCRRLCFHMERWEGSCSNGRLRCCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09038|    From 1 To 61 E-value: 8e-31 Score: 124
        MRILQLLFEVIVILLLQDVPEARGLSDSQQCRSNHGHCRRLCFHMERWEGSCSNGRLRCCR
  • 2. L12A09037|    From 1 To 60 E-value: 5e-25 Score: 104
        MRILQLLFAIVVILLLQDAP-ARGFSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCR
  • 3. L12A03767|    From 1 To 35 E-value: 0.000000000000004 Score: 72
        GLSDSQQCRSNRGHCRRLCFHMERWEGSCSNGRLR
  • 4. L12A03768|    From 1 To 35 E-value: 0.00000000000001 Score: 70.1
        GLSDTQQCRNNRGHCRRLCFHMERWEGSCSNGRLR
  • 5. L01A003618    From 1 To 37 E-value: 0.00000000000002 Score: 69.7
        FSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 25922  MIC:  2.84 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 2592  MIC:  2.12 μg/ml  ( )  
  •   3  Target:  Bacillus subtilis  MIC:  2.44 μg/ml  ( )  
  •   4  Target:  Candida albicans ATCC 2002  MIC:  4.76 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: