Record in detail


General Info

  • lamp_id:L12A009085
  • Name:
  • FullName:
  • Source:
  • Mass:7233.7 Da
  • Sequence Length:63 aa
  • Isoelectric Point:11.96
  • Activity:Antimicrobial
  • Sequence
        MRLHHLLLAVLFLVLSAGSGFTQRVRNPQSCRWNMGVCIPFWCRVGMRQIGTCFGPRVPCCRR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09085|    From 1 To 63 E-value: 3e-32 Score: 128
        MRLHHLLLAVLFLVLSAGSGFTQRVRNPQSCRWNMGVCIPFWCRVGMRQIGTCFGPRVPCCRR
  • 2. L03A000262    From 1 To 63 E-value: 3e-31 Score: 125
        MRLHHLLLAVLFLVLSAGSGFTQRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • 3. L12A09083|    From 1 To 63 E-value: 2e-24 Score: 102
        MRLHHLLLAVLFLDLSAGSGFTQSVRNPQSCRWNMDVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • 4. L05A0DEF73    From 1 To 43 E-value: 6e-20 Score: 87.8
        FTQRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • 5. L03A000267    From 1 To 63 E-value: 3e-19 Score: 85.5
        MRLHHLLLVLLFLVLSAGSGFTQVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Xanthomonas axonopodis pv. vesicatoria 2133-2  MIC:  6.2-12.5 μM  ( )  
  •   2  Target:  Pseudomonas syringae pv. syringae EPS 94  MIC:  12.5-25 μM  ( )  
  •   3  Target:  Erwinia amylovora PMV 6076  MIC:  >50 μM  ( )  
  •   4  Target:  Fusarium oxysporum f. sp. lycopersici ATCC 201829  MIC:  <3.1 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: