Record in detail


General Info

  • lamp_id:L12A009160
  • Name:
  • FullName:
  • Source:
  • Mass:5360.2 Da
  • Sequence Length:47 aa
  • Isoelectric Point:4.41
  • Activity:Antibacterial
  • Sequence
        MRNDVLTLTNPMEEKELEQILGGGNGVLKTISHECNMNTWQFLFTCC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09160

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09160|    From 1 To 47 E-value: 3e-23 Score: 99
        MRNDVLTLTNPMEEKELEQILGGGNGVLKTISHECNMNTWQFLFTCC
  • 2. L12A09161|    From 1 To 47 E-value: 1e-22 Score: 96.7
        MRNDVLTLTNPMEENELEQILGGGNGVLKTISHECNMNTWQFLFTCC
  • 3. L12A08789|    From 1 To 47 E-value: 5e-18 Score: 81.6
        MNKELNALTNPIDEKELEQILGGGNGVIKTISHECHMNTWQFIFTCC
  • 4. L12A08788|    From 1 To 47 E-value: 4e-17 Score: 78.6
        MNKDLNALTNPIDEKELEQILGGGDGVFRTISHECHMNTWMFIFTCC
  • 5. L12A08787|    From 1 To 47 E-value: 5e-17 Score: 78.2
        MNKDLNALTNPIDEKELEQILGGGDGVFRTISHECAMNTWMFIFTCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus epidermidis KCTC 1917  MIC:  8 μM  ( )  
  •   2  Target:  Staphylococcus aureus KCTC 1621  MIC:  4 μM  ( )  
  •   3  Target:  Escherichia coli KCTC 1682  MIC:  8 μM  ( )  
  •   4  Target:  Pseudomonas aeruginosa KCTC 1637  MIC:  16 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: