Record in detail


General Info

  • lamp_id:L12A009215
  • Name:
  • FullName:
  • Source:
  • Mass:10068.2 Da
  • Sequence Length:94 aa
  • Isoelectric Point:7.17
  • Activity:Antimicrobial
  • Sequence
        MRTLAILAAILLVALQAQAESLQTAADEAVTQYPSEEDHKDVTVSFAGNGLSAFMASGSRARAVCYCRSGCCDYPESHTGRCTQGGRSYRLCCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09215|    From 1 To 94 E-value: 0 Score: 192
        MRTLAILAAILLVALQAQAESLQTAADEAVTQYPSEEDHKDVTVSFAGNGLSAFMASGSRARAVCYCRSGCCDYPESHTGRCTQGGRSYRLCCR
  • 2. L12A09216|    From 1 To 94 E-value: 2.8026e-45 Score: 171
        MRTLAILAAILLVALQVQAESLQTSSEEAVTQYQPEADDKDVTVSFAGNGLSAFMASGSQARAVCYCRTGCCDYPESHIGRCTQGGRSYRLCCR
  • 3. L12A09213|    From 1 To 94 E-value: 5e-32 Score: 127
        MRTLAILAAILLVALQAQAESLQERADETATQKQSGEDNQDLAVSFAGNGLSTLRASDSQARSTCYCRIGLCAAIESYSGRCYINGRSYRLCCR
  • 4. L12A08310|    From 1 To 94 E-value: 7e-32 Score: 127
        MKTIAILAAILLVALQAQAESLQERADEAATQKQSGEDNQDLAVSFAGNGLSTLRASDSQARSTCYCRSGLCAAIESYSGRCYISGRRYRLCCR
  • 5. L12A09198|    From 1 To 94 E-value: 2e-31 Score: 126
        MRTIAILAAILLVALQAQAESLQERADEAATQKQSGEDNQDLAVSFAGNGLSTLRASDSQARSTCYCRIGLCAAIESYSGRCYISGRRYRLCCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Fusarium graminearum PH-1  IC50:  14 μM  ( )  
  •   2  Target:  Fusarium graminearum PH-1  MIC:  24 μM  ( )  
  •   3  Target:  Fusarium oxysporum f. sp. medicaginis 7F-3  -:  NA -  ( )  
  •   4  Target:  Fusarium oxysporum f. sp. medicaginis 31F-3  -:  NA -  ( )  
  •   5  Target:  Phoma medicaginis STC  IC50:  12.7±1.1 μM  ( )  
  •   6  Target:  Phoma medicaginis WS-2  IC50:  14.8±1.0 μM  ( )  
  •   7  Target:  Colletotrichum trifolii FG-1  -:  NA -  ( )  
  •   8  Target:  Colletotrichum trifolii WS-5  -:  NA -  ( )  
  •   9  Target:  Aphanomyces euteiches MF-1  -:  NA -  ( )  
  •   10  Target:  Aphanomyces euteiches MER4  -:  NA -  ( )  
  •   11  Target:  Fusarium solani  -:  NA -  ( )  
  •   12  Target:  Fusarium tricinctum  -:  NA -  ( )  
  •   13  Target:  Fusarium redolens  -:  NA -  ( )  
  •   14  Target:  Fusarium incarnatum  -:  NA -  ( )  
  •   15  Target:  Xanthomonas alfalfae subsp. alfalfae F3  IC50:  7.9±0.7 μM  ( )  
  •   16  Target:  Pseudomonas syringae pv. syringae ALF3  IC50:  8.8±1.1 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: