Record in detail


General Info

  • lamp_id:L12A009335
  • Name:
  • FullName:
  • Source:
  • Mass:6748.6 Da
  • Sequence Length:66 aa
  • Isoelectric Point:4.17
  • Activity:Antibacterial
  • Sequence
        MSINEKSIVGESFEDLSAADMAMLTGRNDDGVAPASLSFAVSVLSVSFSACSVTVVTRLASCGNCK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09335

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09335|    From 1 To 66 E-value: 1e-32 Score: 130
        MSINEKSIVGESFEDLSAADMAMLTGRNDDGVAPASLSFAVSVLSVSFSACSVTVVTRLASCGNCK
  • 2. L12A08424|    From 13 To 38 E-value: 0.28 Score: 25.8
        NKLELVGPSFEELSLEEMEAIQGSGD
  • 3. L12A11296|    From 48 To 77 E-value: 1.4 Score: 23.5
        LSWQSKWLSINHSACAIRCLAQRRKGGSCR
  • 4. L01A000074    From 5 To 34 E-value: 1.8 Score: 23.1
        ALSFSSKWLTVNHSACAIHCLTKGYKGGRC
  • 5. L12A06773|    From 9 To 26 E-value: 5.1 Score: 21.6
        SFEELSVEEMEAIQGSGD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 29213  MIC:  2.5 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  20 μM  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  20 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: