Record in detail


General Info

  • lamp_id:L12A009339
  • Name:
  • FullName:
  • Source:
  • Mass:6218.2 Da
  • Sequence Length:56 aa
  • Isoelectric Point:7.81
  • Activity:Antimicrobial
  • Sequence
        MSKFDDFDLDVVKVSKQDSKITPQWKSESLCTPGCVTGALQTCFLQTLTCNCKISK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09339|    From 1 To 56 E-value: 1e-27 Score: 113
        MSKFDDFDLDVVKVSKQDSKITPQWKSESLCTPGCVTGALQTCFLQTLTCNCKISK
  • 2. L12A09340|    From 1 To 56 E-value: 2e-26 Score: 109
        MSKFDDFDLDVVKVSKQDSKITPQWKSESVCTPGCVTGLLQTCFLQTITCNCKISK
  • 3. L12A09341|    From 1 To 56 E-value: 3e-26 Score: 108
        MSKFDDFDLDVVKVSKQDSKITPQWKSESVCTPGCVTGVLQTCFLQTITCNCHISK
  • 4. L12A09338|    From 1 To 45 E-value: 8e-18 Score: 80.9
        MSKFDDFDLDVVKVSKQDSKITPQVLSKSLCTPGCITGPLQTCYL
  • 5. L01A000119    From 1 To 32 E-value: 0.00000000000007 Score: 67.8
        WKSESLCTPGCVTGALQTCFLQTLTCNCKISK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 29213  MIC:  40 μM  ( )  
  •   2  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  20 μM  ( )  
  •   3  Target:  Escherichia coli ATCC 25922  MIC:  40 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: