Record in detail


General Info

  • lamp_id:L12A009446
  • Name:
  • FullName:
  • Source:
  • Mass:5142.6 Da
  • Sequence Length:51 aa
  • Isoelectric Point:3.65
  • Activity:Antibacterial
  • Sequence
        MTEEMTLLDLQGMEQTETDSWGGSGHGGGGDSGLSVTGCNGHSGISLLCDL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09446

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09446|    From 1 To 51 E-value: 5e-23 Score: 97.8
        MTEEMTLLDLQGMEQTETDSWGGSGHGGGGDSGLSVTGCNGHSGISLLCDL
  • 2. L12A08800|    From 1 To 42 E-value: 0.014 Score: 30
        MNLFDLQSMETPKEEAMGDVETGSRASLLLCGDSSLSITTCN
  • 3. L12A06317|    From 1 To 41 E-value: 0.14 Score: 26.9
        MALLDLQAMDTPAEDSFGELATG----SQVSLLVCEYSSLSVVLC
  • 4. L12A06318|    From 1 To 37 E-value: 0.29 Score: 25.8
        MALLDLQTMESDEHT-------GGGGASTVSLLSCVSAASV-LLC
  • 5. L12A06766|    From 4 To 43 E-value: 0.3 Score: 25.8
        VLELQELDAPNELAYGDPSHGGG--SNLSLLASCANSTVSLL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Bacillus subtilis ATCC 6633  LC:  0.9 μM  ( )  
  •   2  Target:  Staphylococcus aureus 42D  LC:  3.8 μM  ( )  
  •   3  Target:  Staphylococcus aureus 42D  LC:  60 μM  ( )  
  •   4  Target:  Escherichia coli ML-35  LC:  15 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: