Record in detail


General Info

  • lamp_id:L12A009456
  • Name:
  • FullName:
  • Source:
  • Mass:5379.1 Da
  • Sequence Length:53 aa
  • Isoelectric Point:4.19
  • Activity:Antibacterial
  • Sequence
        MTKFENTTSLQALTEQELENTAGGIAPFLIGAGIVAGLGGGFFGGYALARIFG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09456

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09456|    From 1 To 53 E-value: 3e-24 Score: 102
        MTKFENTTSLQALTEQELENTAGGIAPFLIGAGIVAGLGGGFFGGYALARIFG
  • 2. L12A07978|    From 7 To 28 E-value: 0.67 Score: 24.6
        LSKKELLQIQGGIAPI-----IVAGLG
  • 3. L12A08869|    From 62 To 77 E-value: 4.3 Score: 21.9
        VIANGWVSSLGGGYFG
  • 4. L12A09447|    From 2 To 18 E-value: 4.5 Score: 21.9
        TEIKVLNDKELKNVVGG
  • 5. L12A06286|    From 8 To 31 E-value: 4.6 Score: 21.9
        LVEIEAMNSLQELTLEELDNVLGA

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Candida albicans ATCC 10231  MIC:  >250 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 6538  MIC:  31.2 μg/ml  ( )  
  •   3  Target:  Staphylococcus albus ATCC 8799  MIC:  31.2 μg/ml  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 43300  MIC:  >250 μg/ml  ( )  
  •   5  Target:  Escherichia coli ATCC 8099  MIC:  31.2 μg/ml  ( )  
  •   6  Target:  Klebsiella pneumoniae ATCC 13883  MIC:  >250 μg/ml  ( )  
  •   7  Target:  Pseudomonas aeruginosa ATCC 9027  MIC:  31.2 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: