Record in detail


General Info

  • lamp_id:L12A009457
  • Name:
  • FullName:
  • Source:
  • Mass:4368 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.25
  • Activity:Antimicrobial
  • Sequence
        MTKITIPTALSAKVHGEGQHLFEPMAARCTCTTIISSSSTF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09457|    From 1 To 41 E-value: 7e-19 Score: 84.3
        MTKITIPTALSAKVHGEGQHLFEPMAARCTCTTIISSSSTF
  • 2. L12A09490|    From 1 To 41 E-value: 2e-16 Score: 76.3
        MTQIKVPTALIASVHGEGQHLFEPMAARCTCTTIISSSSTF
  • 3. L02A001647    From 1 To 14 E-value: 0.03 Score: 28.9
        RCTCTTIISSSSTF
  • 4. L13A027304    From 1 To 13 E-value: 0.19 Score: 26.6
        CTCTTIISSSSTF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Candida albicans ATCC 10231  MIC:  >250 μg/ml  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 6538  MIC:  >250 μg/ml  ( )  
  •   3  Target:  Staphylococcus albus ATCC 8799  MIC:  >250 μg/ml  ( )  
  •   4  Target:  Staphylococcus aureus ATCC 43300  MIC:  >250 μg/ml  ( )  
  •   5  Target:  Escherichia coli ATCC 8099  MIC:  >250 μg/ml  ( )  
  •   6  Target:  Klebsiella pneumoniae ATCC 13883  MIC:  >250 μg/ml  ( )  
  •   7  Target:  Pseudomonas aeruginosa ATCC 9027  MIC:  >250 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: