Record in detail


General Info

  • lamp_id:L12A009480
  • Name:
  • FullName:
  • Source:
  • Mass:4908.8 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.67
  • Activity:Antibacterial
  • Sequence
        MTNRKILPKEELKKIKGGTPGGIDFISGGPHVAQDVLNAIKNFFK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_09480

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09480|    From 1 To 45 E-value: 3e-21 Score: 92
        MTNRKILPKEELKKIKGGTPGGIDFISGGPHVAQDVLNAIKNFFK
  • 2. L13A013815    From 1 To 27 E-value: 0.00000000005 Score: 58.2
        TPGGIDFISGGPHVAQDVLNAIKNFFK
  • 3. L12A08155|    From 8 To 42 E-value: 1.2 Score: 23.5
        SNIKVIEDNELKAITGGGPGKWLPWLQPAYDFVTG
  • 4. L12A06772|    From 1 To 18 E-value: 1.6 Score: 23.1
        MENLQMLTEEELMEIEGG
  • 5. L12A06770|    From 5 To 20 E-value: 2.7 Score: 22.3
        NYTVLSDEELQKIDGG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Staphylococcus aureus ATCC 6538  MIC:  12.5 μg/ml  ( )  
  •   2  Target:  Micrococcus luteus ATCC 9341  MIC:  8 μg/ml  ( )  
  •   3  Target:  Staphylococcus aureus 1550  MIC:  25 μg/ml  ( )  
  •   4  Target:  Pseudomonas aeruginosa ATCC 9027  MIC:  10 μg/ml  ( )  
  •   5  Target:  Escherichia coli ATCC 2592  MIC:  22 μg/ml  ( )  
  •   6  Target:  Candida albicans ATCC 36232  MIC:  20 μg/ml  ( )  
  •   7  Target:  Candida albicans ATCC 36232  MIC:  >100 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: